Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant ASFV EP402R Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
African swine fever virus
Uniprot ID:
A0A0A7W5A6
Molecular weight:
17.11 kDa

Original price was: $326.00.Current price is: $271.00.

50ug 17% OFF + 271 loyalty points
His Ser230–Ile360
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant ASFV EP402R Protein, N-His

Product name ARO-P16445-100
Uniprot ID A0A0A7W5A6
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence SLRKRKKHVEEIESPPPESNEEEQCQHDDTTSIHEPSPREPLLPKPYSRYQYNTPIYYMRPSTQPLNPFPLPKPCPPPKPCPPPKPCPPPKPCPSAESYSPPKPLPSIPLLPNIPPLSTQNISLIHVDRII
Molecular weight 17.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser230-Ile360
Aliases /Synonyms CD2 homolog, 5HL, CD2v, T-lymphocyte CD2 receptor-like protein, pEP402R, EP402R, EP402R CDS, ASFV-Georgia_4-082, ASFV_Kyiv_2016_131_00086
Reference ARO-P16445
Note For research use only.
Molecular Constructor
His Ser230–Ile360
Product name ARO-P16445-1MG
Uniprot ID A0A0A7W5A6
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence SLRKRKKHVEEIESPPPESNEEEQCQHDDTTSIHEPSPREPLLPKPYSRYQYNTPIYYMRPSTQPLNPFPLPKPCPPPKPCPPPKPCPPPKPCPSAESYSPPKPLPSIPLLPNIPPLSTQNISLIHVDRII
Molecular weight 17.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser230-Ile360
Aliases /Synonyms CD2 homolog, 5HL, CD2v, T-lymphocyte CD2 receptor-like protein, pEP402R, EP402R, EP402R CDS, ASFV-Georgia_4-082, ASFV_Kyiv_2016_131_00086
Reference ARO-P16445
Note For research use only.
Molecular Constructor
His Ser230–Ile360
Product name ARO-P16445-50
Uniprot ID A0A0A7W5A6
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence SLRKRKKHVEEIESPPPESNEEEQCQHDDTTSIHEPSPREPLLPKPYSRYQYNTPIYYMRPSTQPLNPFPLPKPCPPPKPCPPPKPCPPPKPCPSAESYSPPKPLPSIPLLPNIPPLSTQNISLIHVDRII
Molecular weight 17.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser230-Ile360
Aliases /Synonyms CD2 homolog, 5HL, CD2v, T-lymphocyte CD2 receptor-like protein, pEP402R, EP402R, EP402R CDS, ASFV-Georgia_4-082, ASFV_Kyiv_2016_131_00086
Reference ARO-P16445
Note For research use only.
Molecular Constructor
His Ser230–Ile360

There are no reviews yet.

Be the first to review “Recombinant ASFV EP402R Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products