Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant ASFV I177L Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
African swine fever virus
Uniprot ID:
YP_009927266
Molecular weight:
20.16 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Lys22–Phe177
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant ASFV I177L Protein, N-His

Product name ARO-P12756-100
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177
Product name ARO-P12756-1MG
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177
Product name ARO-P12756-50
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177

Introduction

Recombinant proteins are proteins that are artificially produced through genetic engineering techniques. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and agriculture. One such recombinant protein is the Recombinant ASFV I177L Protein, which has gained significant attention in recent years due to its potential as an antigen for the development of vaccines against African Swine Fever Virus (ASFV).

Structure of Recombinant ASFV I177L Protein

The Recombinant ASFV I177L Protein is a 177 amino acid protein that is derived from the I177L gene of the African Swine Fever Virus. This protein is composed of a single polypeptide chain with a molecular weight of approximately 20 kDa. The protein has a well-defined three-dimensional structure, which has been elucidated through X-ray crystallography. It consists of two domains, a large domain, and a small domain, connected by a flexible linker region. The large domain is responsible for the protein’s enzymatic activity, while the small domain is involved in protein-protein interactions.

Activity of Recombinant ASFV I177L Protein

The Recombinant ASFV I177L Protein is a highly active protein with multiple enzymatic functions. It belongs to the superfamily of metal-dependent hydrolases and exhibits phospholipase A2 (PLA2) and lysophospholipase (LPL) activities. These activities are essential for the virus’s replication and pathogenesis as they play a crucial role in the virus’s entry into the host cell and the release of viral particles from infected cells.

The PLA2 activity of the Recombinant ASFV I177L Protein is responsible for the hydrolysis of phospholipids, which are critical components of cell membranes. This activity allows the virus to enter the host cell by disrupting the cell membrane, facilitating the fusion of the virus with the cell membrane. The LPL activity of the protein is involved in the release of viral particles from infected cells, which is essential for the spread of the virus in the host.

Application of Recombinant ASFV I177L Protein

The Recombinant ASFV I177L Protein has gained significant attention as a potential antigen for the development of vaccines against ASFV. The protein’s crucial role in the virus’s replication and pathogenesis makes it an ideal target for vaccine development. By targeting this protein, the vaccine can effectively prevent the virus’s entry into host cells and its spread within the host.

Several studies have demonstrated the effectiveness of the Recombinant ASFV I177L Protein as an antigen for vaccine development. In one study, the protein was used to develop a subunit vaccine, which showed promising results in protecting pigs against ASFV infection. Another study used the protein to develop a DNA vaccine, which induced a strong immune response in pigs and provided protection against the virus.

Apart from its application in vaccine development, the Recombinant ASFV I177L Protein also has potential in diagnostic tests for ASFV. The protein’s enzymatic activities make it an ideal candidate for the development of sensitive and specific diagnostic assays for the virus.

Conclusion

In conclusion, the Recombinant ASFV I177L Protein is a highly active protein with multiple enzymatic functions. Its well-defined structure and crucial role in the virus’s replication and pathogenesis make it an ideal target for vaccine development against ASFV. With further research and development, this protein has the potential to play a significant role in controlling and preventing the spread of ASFV, which is a significant threat to the global swine industry.

SDS-PAGE for Recombinant ASFV I177L Protein, N-His

SDS-PAGE for Recombinant ASFV I177L Protein, N-His

Recombinant ASFV I177L Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant ASFV I177L Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant ASFV I177L Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products