Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Bovine LGB/Beta-lactoglobulin Protein, C-His

Host species:
Yeast
Origin species:
Bovine
Uniprot ID:
P02754
Molecular weight:
19.09 kDa

Original price was: $330.00.Current price is: $287.00.

50ug 13% OFF + 287 loyalty points
Leu17–Ile178
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Bovine LGB/Beta-lactoglobulin Protein, C-His

Product name ARO-P11494-100
Uniprot ID P02754
Origin species Bovine
Expression system Eukaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 19.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11494
Note For research use only.
Molecular Constructor
Leu17–Ile178
Product name ARO-P11494-1MG
Uniprot ID P02754
Origin species Bovine
Expression system Eukaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 19.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11494
Note For research use only.
Molecular Constructor
Leu17–Ile178
Product name ARO-P11494-50
Uniprot ID P02754
Origin species Bovine
Expression system Eukaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 19.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11494
Note For research use only.
Molecular Constructor
Leu17–Ile178

Recombinant Bovine LGB/Beta-lactoglobulin Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Bovine LGB/Beta-lactoglobulin Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products