Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Candida albicans CSA2 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot ID:
Q5A0X8
Molecular weight:
13.02 kDa

Original price was: $494.00.Current price is: $392.00.

100ug 21% OFF + 392 loyalty points
Asn34–Asn147
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Candida albicans CSA2 Protein, C-His

Recombinant Candida albicans CSA2 Protein, C-His

Product name ARO-P10896-100
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Prokaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 13.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10896
Note For research use only.
Molecular Constructor
Asn34–Asn147
Product name ARO-P10896-1MG
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Prokaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 13.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10896
Note For research use only.
Molecular Constructor
Asn34–Asn147
Product name ARO-P10896-50
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Prokaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 13.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10896
Note For research use only.
Molecular Constructor
Asn34–Asn147

Recombinant Candida albicans CSA2 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Candida albicans CSA2 Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products