Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant CVA6 P2A/Protease 2A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Coxsackievirus A6 (CVA6)
Uniprot ID:
A0A0H3YLW6
Molecular weight:
18.77 kDa

Original price was: $499.00.Current price is: $387.00.

100ug 22% OFF + 387 loyalty points
His Gly871–Gln1020
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant CVA6 P2A/Protease 2A Protein, N-His

Product name ARO-P15992-100
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020
Product name ARO-P15992-1MG
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020
Product name ARO-P15992-50
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020

SDS-PAGE for Recombinant CVA6 P2A/Protease 2A Protein, N-His

SDS-PAGE for Recombinant CVA6 P2A/Protease 2A Protein, N-His

Recombinant CVA6 P2A/Protease 2A Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant CVA6 P2A/Protease 2A Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products