Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-2 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Uniprot ID:
P18356
Molecular weight:
13.73 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Met477–Gln580
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-2 Envelope protein E, N-His

Product name ARO-P12713-100
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580
Product name ARO-P12713-1MG
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580
Product name ARO-P12713-50
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580

Introduction

Recombinant DENV-2 Envelope protein E, also known as Recombinant Dengue virus type 2 Envelope protein E, is a genetically engineered version of the envelope protein E from Dengue virus type 2 (DENV-2). This protein plays a crucial role in the structure and function of the virus, making it an important target for research and development of vaccines and therapeutics against Dengue virus.

Structure of Recombinant DENV-2 Envelope protein E

The recombinant DENV-2 Envelope protein E is composed of 495 amino acids and has a molecular weight of approximately 55 kDa. It shares a high degree of sequence homology with the native envelope protein E of DENV-2, with only a few amino acid substitutions introduced during the recombinant protein production process.

The protein has a complex three-dimensional structure, consisting of three domains: domain I, domain II, and domain III. Domain I and II are highly conserved among different serotypes of Dengue virus, while domain III is more variable. The domains are connected by flexible hinges, allowing the protein to undergo conformational changes during virus entry and assembly.

Activity of Recombinant DENV-2 Envelope protein E

The recombinant DENV-2 Envelope protein E plays a crucial role in the viral life cycle, as it is responsible for mediating virus attachment and entry into host cells. The protein binds to specific receptors on the surface of host cells, triggering a series of events that lead to virus fusion and release of the viral genome into the host cell.

In addition to its role in virus entry, the envelope protein E also plays a role in virus assembly and release. It interacts with other viral proteins to form the viral envelope, which surrounds and protects the viral genome. The protein is also involved in the budding process, where newly formed virus particles are released from the host cell.

Application of Recombinant DENV-2 Envelope protein E

The recombinant DENV-2 Envelope protein E has a wide range of applications in the field of Dengue virus research and development. One of the major applications is in the development of vaccines against Dengue virus. The protein is a key antigen in many vaccine candidates, as it can elicit a strong immune response and provide protection against multiple serotypes of Dengue virus.

Another important application of the recombinant protein is in the development of diagnostic tests for Dengue virus. The protein can be used as an antigen in serological tests, where it can detect the presence of antibodies against Dengue virus in patient samples. It can also be used in antigen-based tests to directly detect the virus in patient samples.

Furthermore, the recombinant DENV-2 Envelope protein E is also used in research studies to better understand the structure, function, and interactions of the protein with other viral and host factors. This knowledge can aid in the development of new antiviral therapies and drugs that target the envelope protein E.

Conclusion

In summary, the recombinant DENV-2 Envelope protein E is a crucial component of Dengue virus and has a variety of important functions in the viral life cycle. Its structure, activity, and applications make it a valuable tool for research and development in the fight against Dengue virus. With ongoing advancements in recombinant protein technology, the potential for this protein to contribute to the development of effective vaccines and therapeutics against Dengue virus is promising.

Recombinant DENV-2 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-2 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products