Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Dog IFNA3/IFN-alpha-3 Protein, N-Trx-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dog
Uniprot ID:
O97945
Molecular weight:
36.36 kDa

Original price was: $307.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
Trx-His Cys24–Lys187
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Dog IFNA3/IFN-alpha-3 Protein, N-Trx-His

Product name ARO-P15848-100
Uniprot ID O97945
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence CHLPDTHSLRNWRVLTLLGQMRRLSASSCDHYTTDFAFPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTNTSSAPWNMTLLEELCSGLSEQLDDLDACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSLTILQERVRRRK
Molecular weight 36.36 kDa
Protein delivered with Tag? N-Terminal Trx-His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Lys187
Aliases /Synonyms Interferon alpha-3, IFN-alpha-3
Reference ARO-P15848
Note For research use only.
Molecular Constructor
Trx-His Cys24–Lys187
Product name ARO-P15848-1MG
Uniprot ID O97945
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence CHLPDTHSLRNWRVLTLLGQMRRLSASSCDHYTTDFAFPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTNTSSAPWNMTLLEELCSGLSEQLDDLDACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSLTILQERVRRRK
Molecular weight 36.36 kDa
Protein delivered with Tag? N-Terminal Trx-His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Lys187
Aliases /Synonyms Interferon alpha-3, IFN-alpha-3
Reference ARO-P15848
Note For research use only.
Molecular Constructor
Trx-His Cys24–Lys187
Product name ARO-P15848-50
Uniprot ID O97945
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence CHLPDTHSLRNWRVLTLLGQMRRLSASSCDHYTTDFAFPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTNTSSAPWNMTLLEELCSGLSEQLDDLDACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSLTILQERVRRRK
Molecular weight 36.36 kDa
Protein delivered with Tag? N-Terminal Trx-His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Lys187
Aliases /Synonyms Interferon alpha-3, IFN-alpha-3
Reference ARO-P15848
Note For research use only.
Molecular Constructor
Trx-His Cys24–Lys187

There are no reviews yet.

Be the first to review “Recombinant Dog IFNA3/IFN-alpha-3 Protein, N-Trx-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products