Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Ectromelia virus A33R Protein, N-His & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Ectromelia virus
Uniprot ID:
Q66824
Molecular weight:
18.78 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Leu59–Asn185
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Ectromelia virus A33R Protein, N-His & C-His

Product name ARO-P10931-100
Uniprot ID Q66824
Origin species Ectromelia virus
Expression system Prokaryotic expression
Raw Antigen Sequence LNQCMSANEVAITDSAVDVAATSSTHRKVASSTTQYDRKESCNGLYYQGSCYILHSDYKSFEDAKANCTVESLILPNKSDVLATWLAEYVEDTWGSDGNPITKTTSEYQDSDVSREVRKYFCVKIMN
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu59-Asn185
Aliases /Synonyms Protein OPG161, A33R homolog gene, EVHE155, EVI155, EVM1155, EVM135, EVM4155, EVM5155, EVMH155, EVMK155, Ectromelia virus
Reference ARO-P10931
Note For research use only.
Molecular Constructor
Leu59–Asn185
Product name ARO-P10931-1MG
Uniprot ID Q66824
Origin species Ectromelia virus
Expression system Prokaryotic expression
Raw Antigen Sequence LNQCMSANEVAITDSAVDVAATSSTHRKVASSTTQYDRKESCNGLYYQGSCYILHSDYKSFEDAKANCTVESLILPNKSDVLATWLAEYVEDTWGSDGNPITKTTSEYQDSDVSREVRKYFCVKIMN
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu59-Asn185
Aliases /Synonyms Protein OPG161, A33R homolog gene, EVHE155, EVI155, EVM1155, EVM135, EVM4155, EVM5155, EVMH155, EVMK155, Ectromelia virus
Reference ARO-P10931
Note For research use only.
Molecular Constructor
Leu59–Asn185
Product name ARO-P10931-50
Uniprot ID Q66824
Origin species Ectromelia virus
Expression system Prokaryotic expression
Raw Antigen Sequence LNQCMSANEVAITDSAVDVAATSSTHRKVASSTTQYDRKESCNGLYYQGSCYILHSDYKSFEDAKANCTVESLILPNKSDVLATWLAEYVEDTWGSDGNPITKTTSEYQDSDVSREVRKYFCVKIMN
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu59-Asn185
Aliases /Synonyms Protein OPG161, A33R homolog gene, EVHE155, EVI155, EVM1155, EVM135, EVM4155, EVM5155, EVMH155, EVMK155, Ectromelia virus
Reference ARO-P10931
Note For research use only.
Molecular Constructor
Leu59–Asn185

Recombinant Ectromelia virus A33R Protein, N-His & C-His

There are no reviews yet.

Be the first to review “Recombinant Ectromelia virus A33R Protein, N-His & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products