Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Enhanced GFP Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Aequorea victoria
Uniprot ID:
P42212
Molecular weight:
28.01 kDa

Original price was: $468.00.Current price is: $387.00.

100ug 17% OFF + 387 loyalty points
Met1–Lys238 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Enhanced GFP Protein, C-His

Product name ARO-P15600-100
Uniprot ID P42212
Origin species Aequorea victoria
Expression system Prokaryotic expression
Raw Antigen Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Molecular weight 28.01 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys238
Aliases /Synonyms Green fluorescent protein, eGFP, Enhanced GFP
Reference ARO-P15600
Note For research use only.
Molecular Constructor
Met1–Lys238 His
Product name ARO-P15600-1MG
Uniprot ID P42212
Origin species Aequorea victoria
Expression system Prokaryotic expression
Raw Antigen Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Molecular weight 28.01 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys238
Aliases /Synonyms Green fluorescent protein, eGFP, Enhanced GFP
Reference ARO-P15600
Note For research use only.
Molecular Constructor
Met1–Lys238 His
Product name ARO-P15600-50
Uniprot ID P42212
Origin species Aequorea victoria
Expression system Prokaryotic expression
Raw Antigen Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Molecular weight 28.01 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys238
Aliases /Synonyms Green fluorescent protein, eGFP, Enhanced GFP
Reference ARO-P15600
Note For research use only.
Molecular Constructor
Met1–Lys238 His

SDS-PAGE for Recombinant Enhanced GFP Protein, C-His

SDS-PAGE for Recombinant Enhanced GFP Protein, C-His

Recombinant Enhanced GFP Protein, C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Enhanced GFP Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products