Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HCMV/HHV-5 pp65/UL83 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Uniprot ID:
P06725
Molecular weight:
49.85 kDa

Original price was: $337.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points
GST Thr297–Tyr510
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HCMV/HHV-5 pp65/UL83 Protein, N-GST

Product name ARO-P16039-100
Uniprot ID P06725
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence TSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNLKY
Molecular weight 49.85 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr297-Tyr510
Aliases /Synonyms 65 kDa phosphoprotein, pp65, 65 kDa matrix phosphoprotein, Phosphoprotein UL83, Tegument protein UL83, UL83
Reference ARO-P16039
Note For research use only.
Molecular Constructor
GST Thr297–Tyr510
Product name ARO-P16039-1MG
Uniprot ID P06725
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence TSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNLKY
Molecular weight 49.85 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr297-Tyr510
Aliases /Synonyms 65 kDa phosphoprotein, pp65, 65 kDa matrix phosphoprotein, Phosphoprotein UL83, Tegument protein UL83, UL83
Reference ARO-P16039
Note For research use only.
Molecular Constructor
GST Thr297–Tyr510
Product name ARO-P16039-50
Uniprot ID P06725
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence TSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNLKY
Molecular weight 49.85 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr297-Tyr510
Aliases /Synonyms 65 kDa phosphoprotein, pp65, 65 kDa matrix phosphoprotein, Phosphoprotein UL83, Tegument protein UL83, UL83
Reference ARO-P16039
Note For research use only.
Molecular Constructor
GST Thr297–Tyr510

There are no reviews yet.

Be the first to review “Recombinant HCMV/HHV-5 pp65/UL83 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products