Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Hepatitis B virus/HBV X/HBx Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Hepatitis B virus (HBV)
Uniprot ID:
YP_009173867.1
Molecular weight:
17.83 kDa

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Ala2–Ala154
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Hepatitis B virus/HBV X/HBx Protein, N-His

Product name ARO-P12739-100
Uniprot ID YP_009173867.1
Origin species Hepatitis B virus (HBV)
Expression system Prokaryotic expression
Raw Antigen Sequence AARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Molecular weight 17.83 kDa
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Ala154
Aliases /Synonyms Protein X, HBx, Peptide X, pX, X, x, Hepatitis B Virus (HBV)
Reference ARO-P12739
Note For research use only.
Molecular Constructor
Ala2–Ala154
Product name ARO-P12739-1MG
Uniprot ID YP_009173867.1
Origin species Hepatitis B virus (HBV)
Expression system Prokaryotic expression
Raw Antigen Sequence AARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Molecular weight 17.83 kDa
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Ala154
Aliases /Synonyms Protein X, HBx, Peptide X, pX, X, x, Hepatitis B Virus (HBV)
Reference ARO-P12739
Note For research use only.
Molecular Constructor
Ala2–Ala154
Product name ARO-P12739-50
Uniprot ID YP_009173867.1
Origin species Hepatitis B virus (HBV)
Expression system Prokaryotic expression
Raw Antigen Sequence AARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Molecular weight 17.83 kDa
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Ala154
Aliases /Synonyms Protein X, HBx, Peptide X, pX, X, x, Hepatitis B Virus (HBV)
Reference ARO-P12739
Note For research use only.
Molecular Constructor
Ala2–Ala154

Recombinant Hepatitis B virus/HBV X/HBx Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Hepatitis B virus/HBV X/HBx Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products