Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HIV-1 p24/Capsid protein p24 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human immunodeficiency virus type 1 group M subtype B (isolate LW123) (HIV-1)
Uniprot ID:
Q70622
Molecular weight:
38.11 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Pro133–Leu363
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HIV-1 p24/Capsid protein p24 Protein, N-His-SUMO

Product name ARO-P12718-100
Uniprot ID Q70622
Origin species Human immunodeficiency virus type 1 group M subtype B (isolate LW123) (HIV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Molecular weight 38.11 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro133-Leu363
Aliases /Synonyms Gag polyprotein, Pr55Gag, Capsid protein p24, gag, p24, Human immunodeficiency virus type 1, HIV-1
Reference ARO-P12718
Note For research use only.
Molecular Constructor
Pro133–Leu363
Product name ARO-P12718-1MG
Uniprot ID Q70622
Origin species Human immunodeficiency virus type 1 group M subtype B (isolate LW123) (HIV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Molecular weight 38.11 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro133-Leu363
Aliases /Synonyms Gag polyprotein, Pr55Gag, Capsid protein p24, gag, p24, Human immunodeficiency virus type 1, HIV-1
Reference ARO-P12718
Note For research use only.
Molecular Constructor
Pro133–Leu363
Product name ARO-P12718-50
Uniprot ID Q70622
Origin species Human immunodeficiency virus type 1 group M subtype B (isolate LW123) (HIV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Molecular weight 38.11 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro133-Leu363
Aliases /Synonyms Gag polyprotein, Pr55Gag, Capsid protein p24, gag, p24, Human immunodeficiency virus type 1, HIV-1
Reference ARO-P12718
Note For research use only.
Molecular Constructor
Pro133–Leu363

Recombinant HIV-1 p24/Capsid protein p24 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant HIV-1 p24/Capsid protein p24 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products