Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HPV18 E6/Protein E6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human papillomavirus type 18
Uniprot ID:
P06463
Molecular weight:
21.02 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Met1–Val158
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HPV18 E6/Protein E6 Protein, N-His

Product name ARO-P11543-100
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158
Product name ARO-P11543-1MG
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158
Product name ARO-P11543-50
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158

Introduction to Recombinant HPV18 E6 Protein

Human papillomavirus (HPV) is a common sexually transmitted infection that can cause various types of cancers, including cervical, anal, and oropharyngeal cancer. The most prevalent high-risk HPV type is HPV18, which is responsible for approximately 10% of all cervical cancers. In order to develop effective treatments and preventive measures for HPV-related diseases, scientists have been studying and producing recombinant proteins, such as the Recombinant HPV18 E6 Protein, which plays a crucial role in the development of HPV-related cancers.

Structure of Recombinant HPV18 E6 Protein

Recombinant HPV18 E6 Protein is a 151 amino acid long protein that is produced through genetic engineering techniques. It is a synthetic version of the E6 protein, which is a viral oncoprotein that is essential for HPV-induced carcinogenesis. The recombinant protein has the same amino acid sequence as the natural E6 protein, but it is produced in a controlled laboratory setting, allowing for a pure and consistent product.

The structure of Recombinant HPV18 E6 Protein is similar to other E6 proteins from different HPV types, consisting of two zinc-binding domains and a carboxy-terminal domain. These domains are responsible for the protein’s interactions with cellular proteins, including tumor suppressor proteins, which play a crucial role in HPV-related cancers.

Activity of Recombinant HPV18 E6 Protein

The main function of Recombinant HPV18 E6 Protein is to inactivate tumor suppressor proteins, such as p53 and pRb, by promoting their degradation. This activity is crucial for the virus to replicate and persist in the host cells, leading to the development of cancer. The recombinant protein has been extensively studied in laboratory settings, and its ability to interact with and degrade tumor suppressor proteins has been confirmed.

Additionally, studies have shown that Recombinant HPV18 E6 Protein can also induce cellular transformation, which is a process that results in the uncontrolled growth of cells and is a characteristic of cancer cells. This activity of the recombinant protein further highlights its role in the development of HPV-related cancers.

Application of Recombinant HPV18 E6 Protein

The application of Recombinant HPV18 E6 Protein is primarily in research and diagnostic settings. The recombinant protein is used as an antigen in various laboratory assays to study its interactions with cellular proteins and its role in HPV-induced carcinogenesis. It is also used to develop diagnostic tests for HPV-related diseases, such as cervical cancer, as it can elicit an immune response in individuals infected with HPV18.

Moreover, Recombinant HPV18 E6 Protein has shown potential as a therapeutic target for the treatment of HPV-related cancers. By targeting the protein’s activity, it may be possible to disrupt the virus’s ability to replicate and cause cancer. However, more research is needed to fully understand the potential of the recombinant protein as a therapeutic target.

Conclusion

In conclusion, Recombinant HPV18 E6 Protein is a synthetic version of the viral oncoprotein E6, which plays a crucial role in the development of HPV-related cancers. Its structure, activity, and application have been extensively studied, and it has shown potential as a therapeutic target for the treatment of HPV-related diseases. Further research and development of this recombinant protein may lead to more effective treatments and preventive measures for HPV-related cancers.

Recombinant HPV18 E6/Protein E6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant HPV18 E6/Protein E6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products