Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADAMTSL4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6UY14
Molecular weight:
15.48 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Asp481–Ser601
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADAMTSL4 Protein, N-His

Product name ARO-P11396-100
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601
Product name ARO-P11396-1MG
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601
Product name ARO-P11396-50
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601

Introduction

Recombinant Human ADAMTSL4 Protein is a protein that is produced through genetic engineering techniques in a laboratory setting. This protein is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family and is involved in various biological processes such as extracellular matrix organization, cell adhesion, and tissue development.

Structure of Recombinant Human ADAMTSL4 Protein

The structure of Recombinant Human ADAMTSL4 Protein is composed of 1080 amino acids with a molecular weight of approximately 120 kDa. It contains a signal peptide at the N-terminus, followed by a prodomain, a metalloproteinase domain, a disintegrin-like domain, a thrombospondin type 1 motif, and a cysteine-rich domain at the C-terminus.

The metalloproteinase domain of Recombinant Human ADAMTSL4 Protein is responsible for its enzymatic activity, which involves the cleavage of extracellular matrix proteins. The disintegrin-like domain is involved in cell adhesion, while the thrombospondin type 1 motif is responsible for binding to extracellular matrix proteins. The cysteine-rich domain is important for protein-protein interactions and is also thought to play a role in protein folding and stability.

Activity of Recombinant Human ADAMTSL4 Protein

Recombinant Human ADAMTSL4 Protein has been shown to have proteolytic activity, specifically towards aggrecan, a major component of cartilage. This activity is important for maintaining the integrity of the extracellular matrix and is crucial for tissue development and homeostasis.

In addition to its enzymatic activity, Recombinant Human ADAMTSL4 Protein has been found to have cell adhesion properties. It can interact with various cell surface receptors and extracellular matrix proteins, which may play a role in cell signaling and tissue development.

Studies have also shown that Recombinant Human ADAMTSL4 Protein can regulate the activity of other proteins, such as transforming growth factor-beta (TGF-β), which is involved in various cellular processes including cell growth, differentiation, and apoptosis. This suggests that Recombinant Human ADAMTSL4 Protein may have a broader role in modulating cellular functions.

Application of Recombinant Human ADAMTSL4 Protein

Recombinant Human ADAMTSL4 Protein has various potential applications in both research and therapeutic settings. Its ability to cleave extracellular matrix proteins makes it a valuable tool for studying tissue development and homeostasis. It can also be used to investigate the role of extracellular matrix proteins in disease processes such as osteoarthritis and cancer.

In terms of therapeutics, Recombinant Human ADAMTSL4 Protein has shown potential in the treatment of cartilage-related disorders. Its ability to degrade aggrecan may be beneficial in preventing or slowing the progression of osteoarthritis. Additionally, its role in regulating TGF-β activity may have implications in cancer therapy, as TGF-β is known to promote tumor growth and metastasis.

Conclusion

In summary, Recombinant Human ADAMTSL4 Protein is a multifunctional protein with important roles in extracellular matrix organization, cell adhesion, and protein regulation. Its structure, activity, and potential applications make it a valuable tool for both research and therapeutic purposes. Further studies on this protein may reveal new insights into its functions and potential uses in various diseases.

Recombinant Human ADAMTSL4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADAMTSL4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products