Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADRA2C Protein, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P18825
Molecular weight:
31.06 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
His-KSI Arg232–Arg379
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADRA2C Protein, N-His-KSI

Product name ARO-P16136-100
Uniprot ID P18825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKR
Molecular weight 31.06 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg232-Arg379
Aliases /Synonyms Alpha-2C adrenergic receptor, Alpha-2 adrenergic receptor subtype C4, Alpha-2C adrenoreceptor, Alpha-2C adrenoceptor, Alpha-2CAR, ADRA2C, ADRA2L2, ADRA2RL2
Reference ARO-P16136
Note For research use only.
Molecular Constructor
His-KSI Arg232–Arg379
Product name ARO-P16136-1MG
Uniprot ID P18825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKR
Molecular weight 31.06 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg232-Arg379
Aliases /Synonyms Alpha-2C adrenergic receptor, Alpha-2 adrenergic receptor subtype C4, Alpha-2C adrenoreceptor, Alpha-2C adrenoceptor, Alpha-2CAR, ADRA2C, ADRA2L2, ADRA2RL2
Reference ARO-P16136
Note For research use only.
Molecular Constructor
His-KSI Arg232–Arg379
Product name ARO-P16136-50
Uniprot ID P18825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKR
Molecular weight 31.06 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg232-Arg379
Aliases /Synonyms Alpha-2C adrenergic receptor, Alpha-2 adrenergic receptor subtype C4, Alpha-2C adrenoreceptor, Alpha-2C adrenoceptor, Alpha-2CAR, ADRA2C, ADRA2L2, ADRA2RL2
Reference ARO-P16136
Note For research use only.
Molecular Constructor
His-KSI Arg232–Arg379

SDS-PAGE for Recombinant Human ADRA2C Protein, N-His-KSI

SDS-PAGE for Recombinant Human ADRA2C Protein, N-His-KSI

Recombinant Human ADRA2C Protein, N-His-KSI, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human ADRA2C Protein, N-His-KSI”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products