Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AIMP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q12904
Molecular weight:
20.44 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Lys148–Lys312
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AIMP1, N-His

Product name ARO-P13456-100
Uniprot ID Q12904
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Molecular weight 20.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys148-Lys312
Aliases /Synonyms AIMP1, Endothelial monocyte-activating polypeptide II, EMAP-II, Aminoacyl tRNA synthase complex-interacting multifunctional protein 1, EMAP-2, SCYE1, EMAP2, Multisynthase complex auxiliary component p43, Small inducible cytokine subfamily E member 1
Reference ARO-P13456
Note For research use only.
Molecular Constructor
Lys148–Lys312
Product name ARO-P13456-1MG
Uniprot ID Q12904
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Molecular weight 20.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys148-Lys312
Aliases /Synonyms AIMP1, Endothelial monocyte-activating polypeptide II, EMAP-II, Aminoacyl tRNA synthase complex-interacting multifunctional protein 1, EMAP-2, SCYE1, EMAP2, Multisynthase complex auxiliary component p43, Small inducible cytokine subfamily E member 1
Reference ARO-P13456
Note For research use only.
Molecular Constructor
Lys148–Lys312
Product name ARO-P13456-50
Uniprot ID Q12904
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Molecular weight 20.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys148-Lys312
Aliases /Synonyms AIMP1, Endothelial monocyte-activating polypeptide II, EMAP-II, Aminoacyl tRNA synthase complex-interacting multifunctional protein 1, EMAP-2, SCYE1, EMAP2, Multisynthase complex auxiliary component p43, Small inducible cytokine subfamily E member 1
Reference ARO-P13456
Note For research use only.
Molecular Constructor
Lys148–Lys312

Recombinant Human AIMP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AIMP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products