Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AKR1C3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P42330
Molecular weight:
39.02 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
Met1–Tyr323
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AKR1C3 Protein, N-His

Product name ARO-P11759-100
Uniprot ID P42330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Molecular weight 39.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr323
Aliases /Synonyms 3-alpha-hydroxysteroid dehydrogenase type 2, Aldo-keto reductase family 1 member C3, Testosterone 17-beta-dehydrogenase 5, 3-alpha-HSD type II, brain, DD3, DD-3, PGFS, Prostaglandin F synthase, 17-beta-HSD 5, Chlordecone reductase homolog HAKRb, Dihydrodiol dehydrogenase type I, Dihydrodiol dehydrogenase 3, HSD17B5, 17-beta-hydroxysteroid dehydrogenase type 5, HA1753, KIAA0119, DDH1, 3-alpha-HSD type 2, AKR1C3
Reference ARO-P11759
Note For research use only.
Molecular Constructor
Met1–Tyr323
Product name ARO-P11759-1MG
Uniprot ID P42330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Molecular weight 39.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr323
Aliases /Synonyms 3-alpha-hydroxysteroid dehydrogenase type 2, Aldo-keto reductase family 1 member C3, Testosterone 17-beta-dehydrogenase 5, 3-alpha-HSD type II, brain, DD3, DD-3, PGFS, Prostaglandin F synthase, 17-beta-HSD 5, Chlordecone reductase homolog HAKRb, Dihydrodiol dehydrogenase type I, Dihydrodiol dehydrogenase 3, HSD17B5, 17-beta-hydroxysteroid dehydrogenase type 5, HA1753, KIAA0119, DDH1, 3-alpha-HSD type 2, AKR1C3
Reference ARO-P11759
Note For research use only.
Molecular Constructor
Met1–Tyr323
Product name ARO-P11759-50
Uniprot ID P42330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Molecular weight 39.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr323
Aliases /Synonyms 3-alpha-hydroxysteroid dehydrogenase type 2, Aldo-keto reductase family 1 member C3, Testosterone 17-beta-dehydrogenase 5, 3-alpha-HSD type II, brain, DD3, DD-3, PGFS, Prostaglandin F synthase, 17-beta-HSD 5, Chlordecone reductase homolog HAKRb, Dihydrodiol dehydrogenase type I, Dihydrodiol dehydrogenase 3, HSD17B5, 17-beta-hydroxysteroid dehydrogenase type 5, HA1753, KIAA0119, DDH1, 3-alpha-HSD type 2, AKR1C3
Reference ARO-P11759
Note For research use only.
Molecular Constructor
Met1–Tyr323

Recombinant Human AKR1C3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AKR1C3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products