Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ANKRD27 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96NW4
Molecular weight:
28.99 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Met654–Ser902
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ANKRD27 Protein, N-His

Product name ARO-P11162-100
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902
Product name ARO-P11162-1MG
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902
Product name ARO-P11162-50
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902

Introduction

Recombinant Human ANKRD27 Protein, also known as Ankyrin Repeat Domain 27, is a protein that plays a crucial role in various cellular processes. It is a recombinant protein, meaning it is produced through genetic engineering techniques, and is widely used in scientific research and medical applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human ANKRD27 Protein.

Structure of Recombinant Human ANKRD27 Protein

The ANKRD27 gene encodes for the ANKRD27 protein, which is composed of 1,111 amino acids. It belongs to the ankyrin repeat-containing protein family, which is characterized by multiple repeats of a 33-amino acid motif called an ankyrin repeat. These repeats form a solenoid structure, with each repeat consisting of two alpha helices separated by a loop. The ANKRD27 protein contains 15 ankyrin repeats, which are responsible for its binding to various target proteins.

In addition to the ankyrin repeats, ANKRD27 also has a nuclear localization signal (NLS) and a nuclear export signal (NES), indicating its ability to shuttle between the nucleus and the cytoplasm. It also contains a coiled-coil domain, which is involved in protein-protein interactions, and a C-terminal domain that is essential for its function.

Activity of Recombinant Human ANKRD27 Protein

Recombinant Human ANKRD27 Protein is involved in a variety of cellular processes, including transcriptional regulation, protein degradation, and cell signaling. It acts as a scaffold protein, bringing together different proteins to form functional complexes. Its ankyrin repeats allow it to interact with a wide range of target proteins, including transcription factors, kinases, and E3 ubiquitin ligases.

One of the key functions of ANKRD27 is its role in the regulation of gene expression. It can act as a transcriptional co-activator or co-repressor, depending on the target protein it interacts with. It has been shown to regulate the activity of transcription factors such as NF-κB, p53, and c-Myc, which are involved in various cellular processes, including cell growth, differentiation, and apoptosis.

In addition to its role in transcriptional regulation, ANKRD27 also plays a crucial role in protein degradation. It interacts with E3 ubiquitin ligases, such as MDM2 and TRIM63, and promotes the ubiquitination and subsequent degradation of target proteins. This activity is essential for maintaining protein homeostasis and preventing the accumulation of misfolded or damaged proteins.

Applications of Recombinant Human ANKRD27 Protein

Recombinant Human ANKRD27 Protein has a wide range of applications in scientific research and medical fields. Its ability to interact with various target proteins makes it a valuable tool for studying protein-protein interactions and signaling pathways. It can also be used to investigate the role of ANKRD27 in different cellular processes, such as transcriptional regulation and protein degradation.

Furthermore, ANKRD27 has been implicated in various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Its role in regulating gene expression and protein degradation makes it a potential target for therapeutic interventions. Recombinant Human ANKRD27 Protein can be used in drug discovery and development to identify compounds that can modulate its activity and potentially treat these diseases.

In conclusion, Recombinant Human ANKRD27 Protein is a versatile protein with a diverse range of functions. Its structure, activity, and applications make it a valuable tool for scientific research and a potential target for therapeutic interventions. Further studies on ANKRD27 and its interactions with other proteins will continue to unveil its role in various cellular processes and its potential as a therapeutic target.

Conclusion

In this

Recombinant Human ANKRD27 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ANKRD27 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products