Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AP2B1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63010
Molecular weight:
32.19 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Met1–Phe266
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AP2B1, N-His

Product name ARO-P12878-100
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266
Product name ARO-P12878-1MG
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266
Product name ARO-P12878-50
Uniprot ID P63010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKF
Molecular weight 32.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe266
Aliases /Synonyms Adaptor-related protein complex 2 subunit beta, ADTB2, CLAPB1, Beta-adaptin, AP105B, AP-2 complex subunit beta, Plasma membrane adaptor HA2/AP2 adaptin beta subunit, AP2B1, Adaptor protein complex AP-2 subunit beta, Clathrin assembly protein complex 2 beta large chain, Beta-2-adaptin
Reference ARO-P12878
Note For research use only.
Molecular Constructor
Met1–Phe266

Introduction

Recombinant Human AP2B1 is a protein that has been artificially produced in a laboratory setting. It is derived from the human AP2B1 gene, which encodes for the AP2 complex subunit beta-1. This protein plays a crucial role in the process of clathrin-mediated endocytosis, which is responsible for the uptake of molecules and particles into cells. In this article, we will discuss the structure, activity, and applications of Recombinant Human AP2B1.

Structure of Recombinant Human AP2B1

Recombinant Human AP2B1 is a 98 kDa protein that is composed of 900 amino acids. It is a member of the adaptor protein 2 (AP2) complex, which is a heterotetrameric protein complex involved in the formation of clathrin-coated vesicles. The AP2 complex is made up of two large subunits (alpha and beta), a medium subunit (mu), and a small subunit (sigma). Recombinant Human AP2B1 is the beta subunit of the AP2 complex.

The protein structure of Recombinant Human AP2B1 consists of an N-terminal alpha-helical domain, followed by a central hinge region, and a C-terminal globular domain. The alpha-helical domain is responsible for the interaction with the mu subunit, while the globular domain interacts with the cargo molecules to be endocytosed. The hinge region allows for flexibility in the structure, which is important for the function of the protein.

Activity of Recombinant Human AP2B1

Recombinant Human AP2B1 is involved in the process of clathrin-mediated endocytosis, which is essential for the uptake of molecules and particles into cells. This process starts with the formation of clathrin-coated pits on the cell membrane, which are then invaginated to form clathrin-coated vesicles. These vesicles then fuse with the early endosome, where the cargo is sorted and transported to its destination within the cell.

The activity of Recombinant Human AP2B1 is dependent on its interactions with other proteins within the AP2 complex. The alpha-helical domain of Recombinant Human AP2B1 interacts with the mu subunit, which is responsible for recognizing and binding to specific cargo molecules. The globular domain of Recombinant Human AP2B1 interacts with the cargo molecules, facilitating their uptake into the cell.

Applications of Recombinant Human AP2B1

Recombinant Human AP2B1 has various applications in both research and medicine. Its role in clathrin-mediated endocytosis makes it a valuable tool for studying this process in cells. Researchers can use Recombinant Human AP2B1 to investigate the mechanisms of endocytosis and its role in various cellular processes.

In medicine, Recombinant Human AP2B1 has potential applications in drug delivery and gene therapy. The ability of this protein to facilitate the uptake of molecules into cells can be harnessed to deliver therapeutic molecules to specific cells or tissues. This could potentially improve the efficacy and specificity of drug treatments.

Furthermore, mutations in the AP2B1 gene have been linked to various diseases, including intellectual disability and autism spectrum disorders. Recombinant Human AP2B1 can be used to study the effects of these mutations and potentially develop treatments for these conditions.

Conclusion

Recombinant Human AP2B1 is an important protein involved in the process of clathrin-mediated endocytosis. Its structure, activity, and applications make it a valuable tool for research and potential therapeutic use. Further studies on this protein could provide valuable insights into the mechanisms of endocytosis and its role in various diseases.

Recombinant Human AP2B1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AP2B1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products