Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ASC/TMS1/PYCARD, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9ULZ3
Molecular weight:
12.16 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Leu112–Ser195
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ASC/TMS1/PYCARD, N-His

Product name ARO-P13007-100
Uniprot ID Q9ULZ3
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Molecular weight 12.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu112-Ser195
Aliases /Synonyms TMS1, CARD5, Caspase recruitment domain-containing protein 5, Apoptosis-associated speck-like protein containing a CARD, PYD and CARD domain-containing protein, ASC, PYCARD, hASC, Target of methylation-induced silencing 1
Reference ARO-P13007
Note For research use only.
Molecular Constructor
Leu112–Ser195
Product name ARO-P13007-1MG
Uniprot ID Q9ULZ3
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Molecular weight 12.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu112-Ser195
Aliases /Synonyms TMS1, CARD5, Caspase recruitment domain-containing protein 5, Apoptosis-associated speck-like protein containing a CARD, PYD and CARD domain-containing protein, ASC, PYCARD, hASC, Target of methylation-induced silencing 1
Reference ARO-P13007
Note For research use only.
Molecular Constructor
Leu112–Ser195
Product name ARO-P13007-50
Uniprot ID Q9ULZ3
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Molecular weight 12.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu112-Ser195
Aliases /Synonyms TMS1, CARD5, Caspase recruitment domain-containing protein 5, Apoptosis-associated speck-like protein containing a CARD, PYD and CARD domain-containing protein, ASC, PYCARD, hASC, Target of methylation-induced silencing 1
Reference ARO-P13007
Note For research use only.
Molecular Constructor
Leu112–Ser195

Recombinant Human ASC/TMS1/PYCARD, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ASC/TMS1/PYCARD, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products