Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ASIC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78348
Molecular weight:
43.10 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
His72–Tyr426
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ASIC1 Protein, N-His

Product name ARO-P11906-100
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426
Product name ARO-P11906-1MG
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426
Product name ARO-P11906-50
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426

Introduction

Recombinant Human ASIC1 Protein, also known as Acid-sensing ion channel 1, is a protein that plays a crucial role in the regulation of acid-sensing and pain sensation in the human body. This protein is a member of the ASIC family of proteins, which are ion channels that are activated by extracellular protons and contribute to the acid-sensing mechanism in the central and peripheral nervous system. In this article, we will discuss the structure, activity, and applications of Recombinant Human ASIC1 Protein in detail.

Structure of Recombinant Human ASIC1 Protein

Recombinant Human ASIC1 Protein is a transmembrane protein that consists of 528 amino acids. It is composed of a large extracellular domain, two transmembrane domains, and a short intracellular C-terminal domain. The extracellular domain contains a conserved cysteine-rich region, which is involved in the formation of disulfide bonds and plays a crucial role in regulating the channel’s activity. The transmembrane domains form the ion channel pore, which allows the passage of ions, and the intracellular C-terminal domain is involved in the regulation of channel activity and trafficking.

Activity of Recombinant Human ASIC1 Protein

Recombinant Human ASIC1 Protein is primarily expressed in sensory neurons and is involved in the detection of extracellular acidosis. It is activated by a decrease in extracellular pH, which leads to the opening of the ion channel and the influx of cations, such as sodium and calcium, into the cell. This influx of ions results in neuronal depolarization, which leads to the sensation of pain. Moreover, Recombinant Human ASIC1 Protein is also involved in various physiological processes, including synaptic transmission, learning, and memory.

The activity of Recombinant Human ASIC1 Protein is tightly regulated by various factors, including pH, temperature, and various modulators. For instance, the channel is activated by low pH, but its activity is also enhanced by high temperatures, which is why it is considered a thermosensitive channel. Additionally, the channel’s activity is modulated by various neurotransmitters, hormones, and signaling molecules, which can either increase or decrease its activity.

Applications of Recombinant Human ASIC1 Protein

The unique properties and functions of Recombinant Human ASIC1 Protein make it an attractive target for various applications in the field of neuroscience and drug discovery. One of the major applications of this protein is in the study of pain sensation and its underlying mechanisms. By understanding the role of Recombinant Human ASIC1 Protein in pain sensation, researchers can develop new therapies and drugs for the treatment of chronic pain conditions.

Moreover, Recombinant Human ASIC1 Protein has also been implicated in various neurological disorders, including migraine, epilepsy, and anxiety. By studying the structure and function of this protein, researchers can gain a better understanding of these disorders and develop new treatments targeting Recombinant Human ASIC1 Protein.

Furthermore, Recombinant Human ASIC1 Protein has also been studied for its potential as a therapeutic target for cancer. Studies have shown that this protein is overexpressed in certain types of cancer cells, and its inhibition can lead to cell death. Therefore, Recombinant Human ASIC1 Protein inhibitors are being explored as a potential treatment for cancer.

Conclusion

In conclusion, Recombinant Human ASIC1 Protein is a crucial protein involved in the regulation of acid-sensing and pain sensation in the human body. Its unique structure and activity make it an attractive target for various applications in the field of neuroscience and drug discovery. Further research on this protein can lead to a better understanding of its role in various physiological and pathological processes, and potentially lead to the development of new treatments for pain and neurological disorders.

Recombinant Human ASIC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ASIC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products