Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP1B1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P05026
Molecular weight:
28.73 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Gly76–Ser303
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP1B1 Protein, N-His

Product name ARO-P12253-100
Uniprot ID P05026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Molecular weight 28.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly76-Ser303
Aliases /Synonyms Sodium/potassium-transporting ATPase subunit beta-1, ATP1B1, Sodium/potassium-dependent ATPase subunit beta-1, ATP1B
Reference ARO-P12253
Note For research use only.
Molecular Constructor
Gly76–Ser303
Product name ARO-P12253-1MG
Uniprot ID P05026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Molecular weight 28.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly76-Ser303
Aliases /Synonyms Sodium/potassium-transporting ATPase subunit beta-1, ATP1B1, Sodium/potassium-dependent ATPase subunit beta-1, ATP1B
Reference ARO-P12253
Note For research use only.
Molecular Constructor
Gly76–Ser303
Product name ARO-P12253-50
Uniprot ID P05026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Molecular weight 28.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly76-Ser303
Aliases /Synonyms Sodium/potassium-transporting ATPase subunit beta-1, ATP1B1, Sodium/potassium-dependent ATPase subunit beta-1, ATP1B
Reference ARO-P12253
Note For research use only.
Molecular Constructor
Gly76–Ser303

Introduction

Recombinant proteins have become an essential tool in biomedical research and drug development due to their ability to mimic naturally occurring proteins with high specificity and activity. One such recombinant protein is the human ATP1B1 protein, which plays a crucial role in cellular energy metabolism and has been extensively studied for its potential applications in various diseases. In this article, we will delve into the structure, activity, and application of recombinant human ATP1B1 protein.

Structure of Recombinant Human ATP1B1 Protein

The ATP1B1 protein, also known as the sodium/potassium-transporting ATPase subunit beta-1, is a transmembrane protein that is composed of 290 amino acids. It is a subunit of the Na+/K+-ATPase enzyme, which is responsible for maintaining the electrochemical gradient across the cell membrane by pumping sodium out and potassium in. The recombinant human ATP1B1 protein is produced by cloning the gene encoding for the protein into a suitable expression vector and expressing it in host cells, such as bacteria or mammalian cells. This allows for the production of large quantities of the protein in a purified form for further studies.

Activity of Recombinant Human ATP1B1 Protein

The main function of the ATP1B1 protein is to regulate the activity of the Na+/K+-ATPase enzyme. It binds to the catalytic subunit of the enzyme and helps in its proper folding and assembly. This, in turn, ensures the proper functioning of the enzyme in maintaining the ionic balance of the cell. The recombinant human ATP1B1 protein has been shown to have similar activity as the native protein, making it a valuable tool for studying the role of the protein in various cellular processes.

Application of Recombinant Human ATP1B1 Protein

The recombinant human ATP1B1 protein has been extensively studied for its potential applications in various diseases. One of the most promising applications is in cancer treatment. Studies have shown that the ATP1B1 protein is overexpressed in many types of cancer, and its inhibition leads to reduced tumor growth and increased sensitivity to chemotherapy. Therefore, the recombinant human ATP1B1 protein can be used as a potential target for cancer therapy.

Furthermore, the ATP1B1 protein has also been implicated in neurological disorders such as schizophrenia and bipolar disorder. The recombinant human ATP1B1 protein can be used to study the role of the protein in these disorders and potentially develop novel treatments.

In addition, the ATP1B1 protein has been shown to have a role in cardiovascular diseases, such as hypertension and heart failure. The recombinant human ATP1B1 protein can be used to study the mechanisms underlying these diseases and develop new therapeutic strategies.

Conclusion

In summary, the recombinant human ATP1B1 protein is a valuable tool for studying the structure, activity, and application of this important protein. Its production in large quantities allows for its use in various research studies and potential therapeutic applications. With further research, the recombinant human ATP1B1 protein has the potential to contribute to the development of new treatments for various diseases.

Recombinant Human ATP1B1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP1B1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products