Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human C1GALT1C1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96EU7
Molecular weight:
34.24 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
His41–Asp318
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human C1GALT1C1 Protein, N-His

Product name ARO-P10707-100
Uniprot ID Q96EU7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND
Molecular weight 34.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His41-Asp318
Aliases /Synonyms C1Gal-T2, Core 1 beta1,3-galactosyltransferase 2, Core 1 beta3-galactosyltransferase-specific molecular chaperone, C38H2-L1, C1GALT1C1, COSMC, C38H2-like protein 1, Core 1 beta3-Gal-T2, C1GalT2, C1GALT1-specific chaperone 1
Reference ARO-P10707
Note For research use only.
Molecular Constructor
His41–Asp318
Product name ARO-P10707-1MG
Uniprot ID Q96EU7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND
Molecular weight 34.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His41-Asp318
Aliases /Synonyms C1Gal-T2, Core 1 beta1,3-galactosyltransferase 2, Core 1 beta3-galactosyltransferase-specific molecular chaperone, C38H2-L1, C1GALT1C1, COSMC, C38H2-like protein 1, Core 1 beta3-Gal-T2, C1GalT2, C1GALT1-specific chaperone 1
Reference ARO-P10707
Note For research use only.
Molecular Constructor
His41–Asp318
Product name ARO-P10707-50
Uniprot ID Q96EU7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND
Molecular weight 34.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His41-Asp318
Aliases /Synonyms C1Gal-T2, Core 1 beta1,3-galactosyltransferase 2, Core 1 beta3-galactosyltransferase-specific molecular chaperone, C38H2-L1, C1GALT1C1, COSMC, C38H2-like protein 1, Core 1 beta3-Gal-T2, C1GalT2, C1GALT1-specific chaperone 1
Reference ARO-P10707
Note For research use only.
Molecular Constructor
His41–Asp318

Recombinant Human C1GALT1C1 Protein, also known as Core 1 Beta 3-Galactosyltransferase 1, is a type II transmembrane glycoprotein that is encoded by the C1GALT1C1 gene. This protein plays a crucial role in the biosynthesis of O-glycans, which are essential for the proper functioning of many glycoproteins. The structure of Recombinant Human C1GALT1C1 Protein has been extensively studied and is composed of 362 amino acids, with a predicted molecular weight of approximately 41 kDa.

The protein consists of three distinct domains: an N-terminal cytoplasmic domain, a transmembrane domain, and a C-terminal catalytic domain. The cytoplasmic domain contains a conserved motif that is responsible for the transfer of the sugar group from the donor molecule to the acceptor molecule. The transmembrane domain anchors the protein to the cell membrane, while the catalytic domain is responsible for the enzymatic activity of the protein.

Activity of Recombinant Human C1GALT1C1 Protein

Recombinant Human C1GALT1C1 Protein is a glycosyltransferase enzyme that catalyzes the transfer of a galactose sugar from a donor molecule to the core 1 structure of O-glycans. This activity is crucial for the proper glycosylation of many proteins, including mucins, which are important for cell adhesion, signaling, and immune response. The activity of Recombinant Human C1GALT1C1 Protein has been shown to be essential for the development and function of various tissues and organs, including the gastrointestinal tract, immune system, and reproductive system.

In addition to its role in O-glycan biosynthesis, Recombinant Human C1GALT1C1 Protein has also been shown to have a regulatory function in the immune response. Studies have demonstrated that this protein can modulate the activity of immune cells, such as T-cells and natural killer cells, by altering the glycosylation patterns of their surface receptors. This activity has been linked to the regulation of immune cell activation, differentiation, and function.

Application of Recombinant Human C1GALT1C1 Protein

The unique structure and activity of Recombinant Human C1GALT1C1 Protein make it a valuable tool in various research and biotechnology applications. One of the most significant applications of this protein is in the production of recombinant glycoproteins with enhanced functionality. By modifying the glycosylation patterns of these proteins, researchers can improve their stability, solubility, and biological activity, making them more suitable for therapeutic use.

Another potential application of Recombinant Human C1GALT1C1 Protein is in the development of vaccines. The protein has been shown to be an important antigen in the immune response against various pathogens, including bacteria and viruses. By using this protein as a vaccine antigen, researchers can potentially enhance the immune response and improve the efficacy of vaccines.

Furthermore, Recombinant Human C1GALT1C1 Protein has also been studied for its potential role in cancer research. Alterations in O-glycosylation patterns have been observed in various types of cancer, and studies have shown that this protein may play a role in these changes. By understanding the role of Recombinant Human C1GALT1C1 Protein in cancer, researchers can potentially develop new diagnostic and therapeutic strategies for this disease.

In conclusion, Recombinant Human C1GALT1C1 Protein is a crucial enzyme involved in the biosynthesis of O-glycans, with a unique structure and activity. Its diverse functions in various biological processes make it a valuable tool in research and biotechnology. Further studies on this protein may lead to new insights into its role in health and disease, as well as potential applications in medicine.

Recombinant Human C1GALT1C1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human C1GALT1C1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products