Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CA5B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2D0
Molecular weight:
34.88 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Cys34–Pro317
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CA5B, N-His

Product name ARO-P12985-100
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317
Product name ARO-P12985-1MG
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317
Product name ARO-P12985-50
Uniprot ID Q9Y2D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Molecular weight 34.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys34-Pro317
Aliases /Synonyms CA-VB, Carbonic anhydrase VB, Carbonic anhydrase 5B, mitochondrial, Carbonate dehydratase VB, CA5B
Reference ARO-P12985
Note For research use only.
Molecular Constructor
Cys34–Pro317

Introduction to Recombinant Human CA5B

Recombinant Human CA5B is a protein that is produced through recombinant DNA technology. It is a member of the carbonic anhydrase (CA) family, which are enzymes that catalyze the reversible conversion of carbon dioxide and water to bicarbonate and protons. CA5B is a cytosolic isoform of carbonic anhydrase that is highly expressed in the brain and has been found to play a crucial role in various physiological processes.

Structure of Recombinant Human CA5B

The human CA5B gene is located on chromosome 16 and consists of 10 exons that encode for a protein of 261 amino acids. The recombinant form of CA5B is produced by inserting the gene into a suitable expression system, such as bacteria or yeast, and allowing it to be expressed and purified. The resulting protein is a homodimer, meaning it is composed of two identical subunits, each with a molecular weight of approximately 30 kDa. The crystal structure of CA5B has been determined, revealing a globular shape with a central active site where the catalytic activity takes place.

Activity of Recombinant Human CA5B

As a member of the CA family, CA5B has been found to have a wide range of activities in various tissues and organs. Its main function is to catalyze the reversible hydration of carbon dioxide to bicarbonate and protons, which is essential for maintaining acid-base balance in the body. In the brain, CA5B has been shown to play a role in the regulation of neuronal activity and neurotransmitter release. It has also been implicated in the production of cerebrospinal fluid and the maintenance of blood-brain barrier integrity. In addition, CA5B has been found to be involved in the acidification of the stomach and the secretion of gastric acid, as well as the production of saliva and tears.

Application of Recombinant Human CA5B

The recombinant form of CA5B has a wide range of potential applications in both research and clinical settings. One of the main applications is in the development of diagnostic tools for various diseases. CA5B has been found to be expressed at high levels in certain types of cancer, such as glioblastoma and breast cancer, making it a potential biomarker for these diseases. In addition, CA5B has been shown to be involved in the progression of Alzheimer’s disease, making it a potential target for therapeutic interventions.

Another potential application of recombinant human CA5B is in the development of new treatments for various disorders. For example, CA5B has been found to play a role in the regulation of intraocular pressure, making it a potential target for the treatment of glaucoma. It has also been shown to be involved in the regulation of insulin secretion, suggesting it could be a target for the treatment of diabetes.

Furthermore, the recombinant form of CA5B has been used in various studies to investigate its role in different physiological processes. For instance, it has been studied in relation to its effects on memory and learning, as well as its involvement in the regulation of breathing and respiration.

Conclusion

In summary, Recombinant Human CA5B is a protein that plays a crucial role in various physiological processes. Its structure, activity, and potential applications make it a valuable tool for both research and clinical purposes. With further studies and developments, the recombinant form of CA5B could potentially lead to new diagnostic tools and treatments for a range of diseases and disorders.

Recombinant Human CA5B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CA5B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products