Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CBS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P35520
Molecular weight:
55.30 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Lys72–Lys551
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CBS Protein, N-His

Product name ARO-P12616-100
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551
Product name ARO-P12616-1MG
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551
Product name ARO-P12616-50
Uniprot ID P35520
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Molecular weight 55.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys72-Lys551
Aliases /Synonyms Serine sulfhydrase, CBS, Cystathionine beta-synthase, Beta-thionase
Reference ARO-P12616
Note For research use only.
Molecular Constructor
Lys72–Lys551

Introduction to Recombinant Human CBS Protein

Recombinant Human CBS Protein, also known as Cystathionine beta-synthase, is a key enzyme involved in the metabolism of sulfur-containing amino acids. It plays a crucial role in maintaining the balance of homocysteine, cysteine, and glutathione in the body. This protein is produced through recombinant DNA technology, making it a highly pure and stable form of the enzyme. In this article, we will explore the structure, activity, and application of Recombinant Human CBS Protein.

Structure of Recombinant Human CBS Protein

The Recombinant Human CBS Protein is a homotetramer, meaning it is composed of four identical subunits. Each subunit is made up of 551 amino acids and has a molecular weight of approximately 63 kDa. The overall structure of the protein is similar to other pyridoxal 5′-phosphate-dependent enzymes, with a central beta-sheet surrounded by alpha-helices.

The active site of Recombinant Human CBS Protein is located at the interface of the four subunits. It contains a pyridoxal 5′-phosphate (PLP) cofactor, which is essential for the catalytic activity of the enzyme. The PLP cofactor is bound to the protein through a Schiff base linkage with a lysine residue, and it plays a crucial role in the conversion of homocysteine to cystathionine.

Activity of Recombinant Human CBS Protein

The primary function of Recombinant Human CBS Protein is to catalyze the condensation of homocysteine and serine to form cystathionine. This reaction is the first step in the transsulfuration pathway, which converts homocysteine to cysteine. This process is essential for the production of glutathione, a powerful antioxidant that protects cells from oxidative stress.

In addition to its role in sulfur amino acid metabolism, Recombinant Human CBS Protein also has a secondary activity in the conversion of homocysteine to methionine. This reaction, known as the remethylation pathway, helps to maintain the balance of homocysteine in the body and prevent the accumulation of toxic levels of this amino acid.

Application of Recombinant Human CBS Protein

Recombinant Human CBS Protein has a wide range of applications in both research and clinical settings. In research, it is commonly used to study the structure and function of the enzyme and to investigate the role of CBS mutations in diseases such as homocystinuria and hyperhomocysteinemia.

In clinical settings, Recombinant Human CBS Protein is used for diagnostic purposes. Mutations in the CBS gene can lead to deficiencies in the enzyme, resulting in elevated levels of homocysteine and a range of health problems. Measurement of CBS activity using Recombinant Human CBS Protein can help to diagnose these conditions and monitor their progression.

Furthermore, Recombinant Human CBS Protein has potential therapeutic applications. It has been used in preclinical studies to treat homocystinuria and hyperhomocysteinemia, with promising results. The enzyme has also been investigated as a potential target for drug development to treat other conditions, such as cardiovascular disease and neurodegenerative disorders.

Conclusion

In summary, Recombinant Human CBS Protein is a crucial enzyme involved in sulfur amino acid metabolism. Its structure, activity, and applications make it a valuable tool for research and clinical purposes. With ongoing research and development, this protein has the potential to make a significant impact in the diagnosis and treatment of various diseases and disorders.

Recombinant Human CBS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CBS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products