Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CCDC93 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q567U6
Molecular weight:
17.46 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Asp20–Ser151
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CCDC93 Protein, N-His

Product name ARO-P12250-100
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151
Product name ARO-P12250-1MG
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151
Product name ARO-P12250-50
Uniprot ID Q567U6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYS
Molecular weight 17.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp20-Ser151
Aliases /Synonyms CCDC93, Coiled-coil domain-containing protein 93
Reference ARO-P12250
Note For research use only.
Molecular Constructor
Asp20–Ser151

Recombinant Human CCDC93 Protein: Structure, Activity, and Application

The human CCDC93 protein, also known as coiled-coil domain containing 93, is a recently identified protein that plays a crucial role in various cellular processes. It is encoded by the CCDC93 gene located on chromosome 4q31.3 and is highly conserved among different species, indicating its importance in biological functions. The recombinant form of this protein has gained significant attention in the field of biotechnology due to its potential applications in research and medicine.

Structure of Recombinant Human CCDC93 Protein

The recombinant human CCDC93 protein is a 20 kDa protein composed of 172 amino acids. It contains a conserved coiled-coil domain at the N-terminus, which is responsible for protein-protein interactions. This domain is followed by a highly conserved region that is essential for the proper folding and stability of the protein. The C-terminus of the protein contains a putative transmembrane domain, suggesting its potential role in membrane-associated functions. The recombinant form of CCDC93 protein is produced through genetic engineering techniques, allowing for the production of large quantities of this protein in a highly pure form.

Activity of Recombinant Human CCDC93 Protein

The CCDC93 protein has been found to be involved in various cellular processes, including cell cycle regulation, DNA damage response, and protein trafficking. It has been shown to interact with several proteins, such as BRCA1, BRCA2, and RAD51, which are known to play critical roles in DNA repair. This suggests that CCDC93 may be involved in the regulation of DNA repair mechanisms. Additionally, studies have also revealed that CCDC93 is essential for the proper functioning of the Golgi apparatus, a cellular organelle involved in protein trafficking and secretion. This further highlights the importance of CCDC93 in maintaining cellular homeostasis.

Application of Recombinant Human CCDC93 Protein

The recombinant form of CCDC93 protein has various potential applications in both research and medicine. One of the major applications of this protein is in the study of DNA repair mechanisms. As CCDC93 interacts with key proteins involved in DNA repair, its recombinant form can be used to investigate the role of CCDC93 in this process. This can lead to a better understanding of the cellular mechanisms involved in maintaining genomic stability, which is crucial for preventing diseases such as cancer.

Furthermore, the recombinant CCDC93 protein can also be used in drug discovery and development. As this protein is involved in the regulation of various cellular processes, it can serve as a potential drug target for diseases associated with DNA damage and protein trafficking defects. In addition, the recombinant form of CCDC93 can be used to produce antibodies that can be used for diagnostic purposes, such as detecting CCDC93 levels in cancer patients.

Conclusion

In summary, the recombinant human CCDC93 protein is a crucial protein involved in various cellular processes. Its structural features and activities make it a promising candidate for further research and potential applications in medicine. The availability of the recombinant form of this protein has opened up new avenues for studying its role in cellular functions and developing novel therapies for diseases associated with CCDC93 dysfunction.

Recombinant Human CCDC93 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CCDC93 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products