Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD156b/ADAM17, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78536
Molecular weight:
30.35 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
His Lys226–Arg473
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD156b/ADAM17, N-His

Product name ARO-P13554-100
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473
Product name ARO-P13554-1MG
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473
Product name ARO-P13554-50
Uniprot ID P78536
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQER
Molecular weight 30.35 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys226-Arg473
Aliases /Synonyms TACE, Snake venom-like protease, ADAM17, CD156b, CSVP, ADAM 17, Disintegrin and metalloproteinase domain-containing protein 17, TNF-alpha convertase, TNF-alpha-converting enzyme
Reference ARO-P13554
Note For research use only.
Molecular Constructor
His Lys226–Arg473

Introduction

Recombinant Human CD156b/ADAM17 is a protein that plays a crucial role in cell signaling and is involved in various physiological and pathological processes. This article will provide a comprehensive description of the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human CD156b/ADAM17

Recombinant Human CD156b/ADAM17 is a type I transmembrane protein that belongs to the ADAM (A Disintegrin And Metalloproteinase) family. It is also known as tumor necrosis factor-alpha converting enzyme (TACE) due to its ability to cleave and release the pro-inflammatory cytokine TNF-α from the cell surface. The protein is composed of several distinct domains, including a pro-domain, a metalloprotease domain, a disintegrin domain, a cysteine-rich domain, an epidermal growth factor-like domain, and a transmembrane domain.

Activity of Recombinant Human CD156b/ADAM17

Recombinant Human CD156b/ADAM17 has multiple functions in various cellular processes. Its main activity is the cleavage of membrane-bound proteins, also known as shedding. This process is crucial for the regulation of cell signaling, as it allows the release of soluble forms of membrane-bound proteins, including growth factors, cytokines, receptors, and adhesion molecules. CD156b/ADAM17 is involved in the shedding of numerous substrates, such as TNF-α, TNF receptors, transforming growth factor-alpha (TGF-α), epidermal growth factor (EGF), and Notch ligands.

In addition to shedding, CD156b/ADAM17 also has proteolytic activity, which is essential for the processing and activation of certain proteins. For example, it cleaves and activates the precursor forms of TNF-α and TGF-α, which are inactive until they are released from the cell surface. This proteolytic activity is also involved in the activation of various signaling pathways, including the EGFR/ERK pathway, which plays a crucial role in cell proliferation and survival.

Applications of Recombinant Human CD156b/ADAM17

The unique structure and activity of Recombinant Human CD156b/ADAM17 make it a valuable tool for various research and therapeutic applications. One of its main applications is in the study of cell signaling and its role in disease processes. CD156b/ADAM17 is involved in various pathological conditions, including inflammation, cancer, and neurodegenerative diseases. Therefore, understanding its activity and regulation can provide valuable insights into the underlying mechanisms of these diseases.

Moreover, CD156b/ADAM17 has potential therapeutic applications due to its ability to regulate cell signaling. Inhibitors of CD156b/ADAM17 have been developed and are currently being investigated for their potential use in the treatment of inflammatory diseases, such as rheumatoid arthritis and psoriasis. In addition, CD156b/ADAM17 inhibitors have shown promising results in preclinical studies for the treatment of cancer, as they can block the activation of signaling pathways involved in tumor growth and metastasis.

Furthermore, the shedding activity of CD156b/ADAM17 has been exploited for the development of diagnostic tools. Soluble forms of membrane-bound proteins, released by CD156b/ADAM17, can be detected in body fluids and used as biomarkers for various diseases. For example, elevated levels of soluble TNF receptors have been associated with inflammatory conditions, and measuring their levels can aid in the diagnosis and monitoring of these diseases.

Conclusion

In summary, Recombinant Human CD156b/ADAM17 is a multifunctional protein with a crucial role in cell signaling and disease processes. Its unique structure and activity make it a valuable tool for research and therapeutic applications. Further studies on this protein can provide a better understanding of its functions and potential for the development of novel treatments for various diseases.

SDS-PAGE for Recombinant Human CD156b/ADAM17, N-His

SDS-PAGE for Recombinant Human CD156b/ADAM17, N-His

Recombinant Human CD156b/ADAM17, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human CD156b/ADAM17, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD156b/ADAM17, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products