Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD16a/FCGR3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P08637
Molecular weight:
24.13 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Gly17–Gln208
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD16a/FCGR3A Protein, N-His

Product name ARO-P10941-100
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208
Product name ARO-P10941-1MG
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208
Product name ARO-P10941-50
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208

Introduction

Recombinant Human CD16a/FCGR3A Protein is a highly versatile protein that plays a crucial role in the immune system. This protein is a member of the Fc gamma receptor family and is encoded by the FCGR3A gene. It is also known as CD16a, FcγRIIIa, or low affinity immunoglobulin gamma Fc region receptor III-A. This protein is widely used in scientific research and clinical applications due to its unique structure and diverse functions. In this article, we will delve into the structure, activity, and applications of Recombinant Human CD16a/FCGR3A Protein.

Structure

Recombinant Human CD16a/FCGR3A Protein is a type I transmembrane protein with a molecular weight of approximately 50 kDa. It is composed of 212 amino acids and has a single immunoglobulin-like extracellular domain, a transmembrane region, and a short cytoplasmic tail. The extracellular domain contains two immunoglobulin-like subdomains, D1 and D2, which are connected by a hinge region. The D1 subdomain is responsible for binding to the Fc portion of immunoglobulins, while the D2 subdomain is involved in binding to other proteins such as cytokines and growth factors.

The cytoplasmic tail of Recombinant Human CD16a/FCGR3A Protein contains a conserved sequence of amino acids known as an immunoreceptor tyrosine-based activation motif (ITAM). This motif is essential for signal transduction and activation of immune cells upon binding to its ligands. The transmembrane region of this protein serves as a link between the extracellular and intracellular domains and is crucial for maintaining the stability and function of the protein.

Activity

Recombinant Human CD16a/FCGR3A Protein is primarily expressed on the surface of natural killer (NK) cells, macrophages, and neutrophils. It acts as a receptor for the Fc portion of immunoglobulins, specifically IgG, and plays a vital role in antibody-dependent cellular cytotoxicity (ADCC). Upon binding to the Fc portion of IgG, this protein triggers a signaling cascade that leads to the activation of immune cells and subsequent killing of target cells.

In addition to its role in ADCC, Recombinant Human CD16a/FCGR3A Protein has also been shown to bind to other ligands, including cytokines and growth factors. This binding can modulate the activity of immune cells and regulate various immune responses, such as inflammation and immune cell proliferation.

Application

Recombinant Human CD16a/FCGR3A Protein has a wide range of applications in both research and clinical settings. Its ability to bind to the Fc portion of immunoglobulins makes it a valuable tool in studying the immune response to various diseases and infections. This protein is often used in in vitro assays to measure ADCC activity and assess the efficacy of therapeutic antibodies.

In addition, Recombinant Human CD16a/FCGR3A Protein has been utilized in the development of immunotherapies for cancer treatment. By engineering this protein to have higher affinity for the Fc portion of IgG, scientists have been able to enhance the ADCC activity of immune cells and improve the efficacy of antibody-based cancer therapies.

Furthermore, Recombinant Human CD16a/FCGR3A Protein has been implicated in various autoimmune and inflammatory diseases, such as rheumatoid arthritis and lupus. Its role in modulating immune cell activity and cytokine production makes it a potential target for therapeutic interventions in these conditions.

Conclusion

<p

Recombinant Human CD16a/FCGR3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD16a/FCGR3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products