Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD339/JAG1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78504
Molecular weight:
26.62 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
His Gly33–Asp250
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD339/JAG1, N-His

Product name ARO-P13553-100
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250
Product name ARO-P13553-1MG
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250
Product name ARO-P13553-50
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250

Recombinant Human CD339/JAG1: Structure, Activity, and Application

Introduction

Recombinant human CD339/JAG1 is a protein that plays a crucial role in cell signaling and development. It is a member of the Notch signaling pathway, which is involved in regulating various cellular processes such as cell proliferation, differentiation, and apoptosis. This protein is produced through genetic engineering techniques, making it a recombinant protein. In this article, we will discuss the structure, activity, and application of recombinant human CD339/JAG1.

Structure of Recombinant Human CD339/JAG1

Recombinant human CD339/JAG1 is a transmembrane protein that is composed of 1218 amino acids. It is a member of the Jagged family of proteins, which are characterized by the presence of a conserved domain known as the Delta/Serrate/LAG-2 (DSL) domain. This domain is responsible for the interaction with Notch receptors, which is essential for the activation of the Notch signaling pathway.

The protein has an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains the DSL domain, as well as multiple EGF-like repeats, which are involved in protein-protein interactions. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain contains a conserved region known as the Ankyrin repeats, which are involved in protein-protein interactions and signaling.

Activity of Recombinant Human CD339/JAG1

Recombinant human CD339/JAG1 is a ligand for Notch receptors, specifically Notch 1, 2, and 3. Upon binding to its receptor, CD339/JAG1 undergoes proteolytic cleavage, releasing its intracellular domain. This intracellular domain then translocates to the nucleus, where it activates the transcription of target genes involved in various cellular processes.

The Notch signaling pathway is crucial for cell fate determination and tissue development. CD339/JAG1 plays a role in regulating cell proliferation, differentiation, and apoptosis. It also plays a role in angiogenesis, immune response, and inflammation. Dysregulation of this pathway has been linked to various diseases, including cancer and developmental disorders.

Application of Recombinant Human CD339/JAG1

Recombinant human CD339/JAG1 has a wide range of applications in both research and medicine. In research, it is used to study the Notch signaling pathway and its role in cellular processes. It is also used to investigate the potential therapeutic effects of targeting this pathway in various diseases.

In medicine, recombinant human CD339/JAG1 has been studied as a potential treatment for diseases such as cancer, cardiovascular diseases, and autoimmune disorders. It has also been investigated as a potential therapy for tissue regeneration and wound healing.

Recombinant Human CD339/JAG1 as an Antigen

In addition to its role as a ligand for Notch receptors, recombinant human CD339/JAG1 also has antigenic properties. This means that it can elicit an immune response and be used as a target for vaccines or immunotherapy. Studies have shown that CD339/JAG1 can induce an immune response in cancer cells, making it a potential target for cancer immunotherapy.

Conclusion

In summary, recombinant human CD339/JAG1 is a crucial protein in the Notch signaling pathway, involved in regulating various cellular processes. Its structure, activity, and applications have been extensively studied and continue to be investigated for potential therapeutic purposes. With its diverse functions and potential as an antigen,

Recombinant Human CD339/JAG1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD339/JAG1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products