Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99618
Molecular weight:
18.91 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Ser119–Ser268
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA3 Protein, N-His

Product name ARO-P10694-100
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268
Product name ARO-P10694-1MG
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268
Product name ARO-P10694-50
Uniprot ID Q99618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser119-Ser268
Aliases /Synonyms C8, TOME-1, CDCA3, GRCC8, Trigger of mitotic entry protein 1, Cell division cycle-associated protein 3, Gene-rich cluster protein C8, TOME1
Reference ARO-P10694
Note For research use only.
Molecular Constructor
Ser119–Ser268

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins with high purity and consistency. One such protein is Recombinant Human CDCA3 Protein, which has gained significant attention in the scientific community due to its unique structure and diverse range of activities. In this article, we will delve into the details of this protein, including its structure, activity, and various applications.

Structure of Recombinant Human CDCA3 Protein

Recombinant Human CDCA3 Protein, also known as Cell Division Cycle Associated 3, is a 27 kDa protein that belongs to the CDCA family. It is composed of 239 amino acids and contains a highly conserved N-terminal domain, a central coiled-coil region, and a C-terminal domain. The N-terminal domain is crucial for the protein’s interaction with other proteins, while the coiled-coil region is responsible for its dimerization. The C-terminal domain is involved in the protein’s binding to DNA, which is essential for its activity.

The crystal structure of Recombinant Human CDCA3 Protein has been determined, revealing that it forms a homodimer in its active form. The dimerization of this protein is crucial for its activity as it enables the formation of a functional complex with other proteins.

Activity of Recombinant Human CDCA3 Protein

Recombinant Human CDCA3 Protein is a multifunctional protein that plays a critical role in cell cycle regulation. It is involved in various cellular processes, including DNA replication, chromosome segregation, and cytokinesis. This protein interacts with other proteins, such as Aurora B kinase and Survivin, to form the chromosomal passenger complex, which is essential for proper cell division.

Furthermore, Recombinant Human CDCA3 Protein has been shown to have a role in DNA damage response. It is recruited to sites of DNA damage and helps in the recruitment of other proteins involved in DNA repair. This protein also plays a role in maintaining genomic stability by preventing the formation of abnormal chromosomal structures.

Applications of Recombinant Human CDCA3 Protein

Due to its diverse range of activities, Recombinant Human CDCA3 Protein has several potential applications in the field of biotechnology and medicine. One of the most promising applications is its use as an antigen in cancer immunotherapy. The overexpression of this protein has been observed in various types of cancer, making it a potential target for cancer treatment. Recombinant Human CDCA3 Protein can be used to stimulate an immune response against cancer cells, leading to their destruction.

In addition to cancer treatment, Recombinant Human CDCA3 Protein has also been studied for its potential in gene therapy. Its role in DNA repair and maintenance of genomic stability makes it an attractive candidate for the treatment of genetic disorders.

Moreover, this protein has also been studied for its potential in developing new drugs for various diseases. Its involvement in cell cycle regulation and DNA damage response makes it a potential target for drug development, particularly in the field of cancer and neurodegenerative diseases.

Conclusion

In conclusion, Recombinant Human CDCA3 Protein is a multifunctional protein with a unique structure and diverse range of activities. Its role in cell cycle regulation, DNA repair, and maintenance of genomic stability makes it a promising candidate for various applications in biotechnology and medicine. Further research on this protein is necessary to fully understand its potential and develop new therapeutic strategies.

Recombinant Human CDCA3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products