Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA4 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BXL8
Molecular weight:
22.79 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu15–Gln108
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA4 Protein, N-His-SUMO

Product name ARO-P11894-100
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108
Product name ARO-P11894-1MG
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108
Product name ARO-P11894-50
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108

Introduction to Recombinant Human CDCA4 Protein

Recombinant Human CDCA4 Protein, also known as Cell Division Cycle Associated 4, is a protein that plays a crucial role in cell division and proliferation. This protein is encoded by the CDCA4 gene and is found in both humans and other mammalian species. Recombinant Human CDCA4 Protein is a valuable tool in scientific research and has potential applications in various fields.

Structure of Recombinant Human CDCA4 Protein

The structure of Recombinant Human CDCA4 Protein is composed of 358 amino acids and has a molecular weight of approximately 39.7 kDa. It belongs to the conserved WD40 repeat protein family and contains seven WD40 repeats, which are known to be involved in protein-protein interactions. These repeats form a beta-propeller structure, which is essential for the function of the protein.

Activity of Recombinant Human CDCA4 Protein

Recombinant Human CDCA4 Protein is a key regulator of cell division and is involved in the G2/M transition of the cell cycle. It interacts with other proteins, such as PLK1 and CDK1, to form complexes that regulate the progression of the cell cycle. It is also involved in the maintenance of genomic stability and has been shown to play a role in DNA damage response.

Furthermore, Recombinant Human CDCA4 Protein has been found to be overexpressed in various types of cancer, including breast, lung, and prostate cancer. It has been suggested that this protein may have potential as a biomarker for cancer diagnosis and prognosis.

Application of Recombinant Human CDCA4 Protein

Recombinant Human CDCA4 Protein has a wide range of applications in scientific research. One of its primary uses is in studying the mechanisms of cell division and proliferation. By studying the interactions of this protein with other cell cycle regulators, researchers can gain a better understanding of the complex processes involved in cell division.

In addition, Recombinant Human CDCA4 Protein has potential applications in cancer research. Its overexpression in various types of cancer makes it a potential target for therapeutic interventions. Further studies on the role of this protein in cancer development and progression may lead to the development of new treatments for cancer.

Moreover, Recombinant Human CDCA4 Protein can also be used in drug screening assays. By studying the effects of different compounds on the activity of this protein, researchers can identify potential drug candidates for cancer treatment.

Conclusion

In summary, Recombinant Human CDCA4 Protein is a crucial protein involved in cell division and proliferation. Its structure, activity, and potential applications make it a valuable tool in scientific research, particularly in the fields of cell biology and cancer research. Further studies on this protein may lead to a better understanding of the cell cycle and potential treatments for cancer.

Recombinant Human CDCA4 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CDCA4 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products