Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDK9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50750
Molecular weight:
39.77 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu15–Ala340
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDK9 Protein, N-His

Product name ARO-P10769-100
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340
Product name ARO-P10769-1MG
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340
Product name ARO-P10769-50
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340

Introduction to Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein, also known as Cyclin Dependent Kinase 9, is a highly conserved protein that plays a crucial role in regulating cell cycle progression and gene transcription. It is a member of the CDK family of proteins, which are key regulators of cell division and proliferation. Recombinant Human CDK9 Protein is produced through genetic engineering techniques, making it a valuable tool for studying its structure, activity, and potential applications.

Structure of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein is a 42 kDa protein consisting of 372 amino acids. It contains a conserved serine/threonine kinase domain and a cyclin-binding domain, which are essential for its activity. The protein also has a T-loop region, which is important for its regulation and interaction with other proteins. Recombinant Human CDK9 Protein has a high degree of homology with its counterparts in other species, indicating its evolutionary conservation and importance in cellular processes.

Activity of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein is a key regulator of the cell cycle, specifically in the G1, S, and G2 phases. It forms a complex with its regulatory partner, Cyclin T, to form the active complex, CDK9/Cyclin T. This complex is responsible for the phosphorylation of the C-terminal domain of RNA polymerase II, which is critical for transcriptional elongation. Additionally, Recombinant Human CDK9 Protein can also phosphorylate other targets, such as transcription factors and RNA splicing factors, to regulate gene expression. Its activity is tightly regulated by other proteins, such as CDK inhibitors and phosphatases, to ensure proper cell cycle progression and transcriptional control.

Application of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein has a wide range of applications in both research and therapeutic settings. Its role in regulating gene transcription makes it a valuable tool for studying gene expression and its dysregulation in diseases such as cancer. Recombinant Human CDK9 Protein can be used in in vitro assays to study its kinase activity and its interaction with other proteins. It can also be used in cell-based assays to investigate its role in cell cycle progression and transcriptional control.

In addition to its research applications, Recombinant Human CDK9 Protein has potential therapeutic applications as well. It has been shown to be a promising target for cancer treatment, as its dysregulation has been linked to various types of cancer. Inhibitors of CDK9 have been developed and are currently being tested in clinical trials for the treatment of cancer. Furthermore, Recombinant Human CDK9 Protein has also been implicated in viral infections, making it a potential target for antiviral therapies.

Conclusion

In summary, Recombinant Human CDK9 Protein is a highly conserved protein with an essential role in regulating cell cycle progression and gene transcription. Its structure, activity, and potential applications make it a valuable tool for scientific research and a promising target for therapeutic interventions. With continued research and development, Recombinant Human CDK9 Protein has the potential to contribute to a better understanding of cellular processes and the development of novel treatments for diseases.

Recombinant Human CDK9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDK9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products