Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEP19 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96LK0
Molecular weight:
17.82 kDa

Original price was: $383.00.Current price is: $327.00.

100ug 15% OFF + 327 loyalty points
Met1–Asp133
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEP19 Protein, N-His

Product name ARO-P11169-100
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133
Product name ARO-P11169-1MG
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133
Product name ARO-P11169-50
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133

Introduction

Recombinant Human CEP19 Protein (rCEP19) is a novel protein that has gained attention in the scientific community due to its potential role in cancer biology. This protein is a product of genetic engineering, where it is produced in large quantities using recombinant DNA technology. In this article, we will explore the structure, activity, and potential applications of rCEP19.

Structure of rCEP19

rCEP19 is a 19 kDa protein that is composed of 175 amino acids. It belongs to the family of centrosomal proteins, which are essential for the proper functioning of the centrosome, a cellular organelle involved in cell division. The structure of rCEP19 consists of a central coiled-coil domain, flanked by two globular domains on either side. This unique structure is crucial for its function and interactions with other proteins.

Activity of rCEP19

The primary function of rCEP19 is to regulate the centrosome cycle, which is essential for cell division. It has been shown to localize to the centrosome during the G1 phase of the cell cycle and then dissociate during mitosis. This localization and dissociation are crucial for the proper duplication of the centrosome and subsequent cell division. Additionally, rCEP19 has been found to interact with other centrosomal proteins, such as CEP350 and CEP170, further highlighting its role in centrosome function.

Moreover, rCEP19 has been shown to be involved in microtubule nucleation, a process that is essential for the formation of the mitotic spindle during cell division. This further emphasizes the importance of rCEP19 in the proper functioning of the centrosome and cell division.

Applications of rCEP19

The potential applications of rCEP19 are vast, especially in the field of cancer biology. Studies have shown that rCEP19 is overexpressed in various cancer types, including breast, lung, and prostate cancer. This overexpression has been linked to increased cell proliferation and tumor growth, making rCEP19 a potential target for cancer therapy.

Furthermore, rCEP19 has been found to be a prognostic marker in certain cancers. In breast cancer, high levels of rCEP19 have been associated with poor patient outcomes, suggesting its potential use as a biomarker for disease progression and treatment response.

In addition, rCEP19 has been identified as a potential antigen for cancer immunotherapy. Antigens are substances that can elicit an immune response, and rCEP19 has been shown to induce an immune response in cancer patients. This makes it a promising candidate for the development of cancer vaccines or targeted immunotherapies.

Conclusion

In summary, rCEP19 is an important protein involved in the regulation of the centrosome cycle and microtubule nucleation. Its unique structure and interactions with other centrosomal proteins make it a crucial player in cell division. The overexpression of rCEP19 in various cancers and its potential as a prognostic marker and antigen for cancer immunotherapy highlight its significance in cancer biology. Further research on rCEP19 could lead to the development of novel cancer treatments and improved patient outcomes.

Recombinant Human CEP19 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CEP19 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products