Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CISD1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZ45
Molecular weight:
22.89 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Ala16–Thr108
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CISD1 Protein, N-His-SUMO

Product name ARO-P11185-100
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108
Product name ARO-P11185-1MG
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108
Product name ARO-P11185-50
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108

Introduction

Recombinant Human CISD1 Protein, also known as CDGSH iron sulfur domain-containing protein 1, is a highly conserved protein that plays a crucial role in cellular processes such as iron metabolism, oxidative stress response, and mitochondrial function. This protein is encoded by the CISD1 gene and is found in various tissues and cell types.

Structure of Recombinant Human CISD1 Protein

The CISD1 gene is located on chromosome 10 in humans and consists of 4 exons. The protein product of this gene is a 127 amino acid long polypeptide with a molecular weight of approximately 14 kDa. Recombinant Human CISD1 Protein is produced by cloning and expressing the CISD1 gene in a suitable host system, such as E. coli or yeast.

The crystal structure of CISD1 protein has been determined and it consists of a CDGSH iron sulfur domain, which is a characteristic feature of this protein family. This domain is responsible for binding to iron and sulfur ions, and plays a critical role in the function of CISD1 protein.

Activity of Recombinant Human CISD1 Protein

Recombinant Human CISD1 Protein is a multifunctional protein that is involved in various cellular processes. One of its main functions is to regulate iron homeostasis by interacting with iron regulatory proteins and modulating their activity. This helps in maintaining the balance of iron levels in the cell, which is crucial for many cellular functions.

CISD1 protein is also involved in the response to oxidative stress, which is a common cellular stressor. It acts as an antioxidant and helps in reducing oxidative damage by scavenging reactive oxygen species. This function is essential for maintaining the health and integrity of cells.

Moreover, CISD1 protein has been found to play a role in mitochondrial function. It is localized in the inner membrane of mitochondria and has been shown to interact with other proteins involved in mitochondrial function and biogenesis. This suggests that CISD1 protein may have a role in maintaining the proper functioning of mitochondria, which are the powerhouses of the cell.

Application of Recombinant Human CISD1 Protein

Recombinant Human CISD1 Protein has diverse applications in both basic research and clinical settings. It is commonly used as an antigen for the production of specific antibodies, which are essential tools for studying the structure and function of this protein. It can also be used in biochemical assays to study its interaction with other proteins or small molecules.

In addition, the role of CISD1 protein in iron metabolism and oxidative stress makes it a potential target for therapeutic interventions. Mutations in the CISD1 gene have been linked to various disorders such as Wolfram syndrome, which is characterized by diabetes and neurodegeneration. Therefore, understanding the function of CISD1 protein may lead to the development of treatments for these diseases.

Conclusion

In conclusion, Recombinant Human CISD1 Protein is a highly conserved and multifunctional protein that plays a critical role in iron metabolism, oxidative stress response, and mitochondrial function. Its structure and activity have been extensively studied, and it has diverse applications in both research and clinical settings. Further research on this protein may lead to a better understanding of its role in various diseases and the development of potential treatments.

Recombinant Human CISD1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CISD1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products