Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CLDN5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00501
Molecular weight:
34.42 kDa

Original price was: $307.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Gly26–Arg81
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CLDN5 Protein, N-GST & C-His

Product name ARO-P11361-100
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81
Product name ARO-P11361-1MG
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81
Product name ARO-P11361-50
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81

Recombinant Human CLDN5 Protein, also known as Claudin-5, is a transmembrane protein that plays a crucial role in the formation and maintenance of tight junctions in endothelial cells. These tight junctions are responsible for regulating the passage of molecules and ions between cells, thus maintaining the integrity of the blood-brain barrier and other epithelial barriers in the body.

Structure of Recombinant Human CLDN5 Protein

The CLDN5 gene is located on chromosome 22q11.21 and encodes for a protein of 220 amino acids. The protein has four transmembrane domains, two extracellular loops, and a cytoplasmic tail. The extracellular loops contain highly conserved regions that are responsible for the interaction with other tight junction proteins, such as occludin and claudin-1.

The recombinant form of CLDN5 protein is produced by cloning the gene into an expression vector and expressing it in a suitable host cell, such as E. coli or mammalian cells. The resulting protein is then purified using various techniques, such as chromatography, to obtain a highly pure and active form of CLDN5.

Activity of Recombinant Human CLDN5 Protein

The primary function of CLDN5 is to regulate the paracellular transport of molecules between cells. It does so by forming homotypic and heterotypic interactions with other claudins and tight junction proteins, thus creating a physical barrier that restricts the passage of molecules and ions.

Studies have shown that CLDN5 is essential for maintaining the integrity of the blood-brain barrier and preventing the leakage of harmful substances into the brain. It is also involved in regulating the permeability of other epithelial barriers, such as the intestinal and renal epithelium.

Additionally, CLDN5 has been shown to play a role in cell signaling and proliferation. It has been reported to interact with various signaling molecules, such as protein kinase C, and regulate their activity. It has also been linked to the development and progression of certain cancers, highlighting its importance in cellular functions beyond tight junction formation.

Applications of Recombinant Human CLDN5 Protein

The recombinant form of CLDN5 protein has various applications in both research and clinical settings. It is commonly used as an antigen in studies involving tight junctions and the blood-brain barrier. Antibodies against CLDN5 can be used to study its expression and localization in different tissues and diseases.

Recombinant CLDN5 protein can also be used in drug discovery and development, particularly in the development of drugs that target the blood-brain barrier. It can also be used in the development of drugs that target tight junctions in other epithelial barriers, such as the intestinal barrier, for the treatment of various diseases.

Furthermore, CLDN5 has been identified as a potential biomarker for certain diseases, such as multiple sclerosis and glioblastoma. Recombinant CLDN5 protein can be used in diagnostic tests to detect the presence of antibodies against CLDN5 in patient samples, which can aid in the diagnosis and monitoring of these diseases.

Conclusion

In conclusion, Recombinant Human CLDN5 Protein is a crucial component of tight junctions in endothelial cells, playing a vital role in maintaining the integrity of various epithelial barriers in the body. Its structure, activity, and applications make it a valuable tool in both research and clinical settings, with potential for further advancements in the future.

Recombinant Human CLDN5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CLDN5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products