Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P01037
Molecular weight:
25.67 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Asp41–Ser141
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

Product name ARO-P12246-100
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141
Product name ARO-P12246-1MG
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141
Product name ARO-P12246-50
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141

Introduction to Recombinant Human CST1 Protein

Recombinant human CST1 protein is a synthetic form of the human cystatin S protein, which is a member of the cystatin superfamily of cysteine protease inhibitors. This protein is produced through genetic engineering techniques, where the gene for human CST1 is inserted into an expression vector and then expressed in a host organism, typically a bacterial or mammalian cell line. Recombinant human CST1 protein has a wide range of applications in both research and clinical settings, and its structure and activity make it a valuable tool in understanding and treating various diseases.

Structure of Recombinant Human CST1 Protein

The recombinant human CST1 protein has a similar structure to the native human cystatin S protein, consisting of 142 amino acids with a molecular weight of approximately 15.8 kDa. It contains a single polypeptide chain with two disulfide bonds, giving it a stable and compact structure. The protein also has a conserved N-terminal glycine residue, which is essential for its inhibitory activity against cysteine proteases. The three-dimensional structure of recombinant human CST1 protein has been determined through X-ray crystallography, revealing its compact and globular shape.

Activity of Recombinant Human CST1 Protein

Recombinant human CST1 protein is a potent inhibitor of cysteine proteases, including cathepsins B, H, and L. These proteases play important roles in various physiological processes, such as protein degradation, antigen processing, and cell signaling. By inhibiting these proteases, recombinant human CST1 protein can regulate these processes and potentially prevent or treat diseases associated with their dysregulation. In addition, recombinant human CST1 protein has been shown to have anti-inflammatory properties by inhibiting the activity of cathepsin S, a protease involved in the activation of immune cells.

In addition to its inhibitory activity, recombinant human CST1 protein has been found to have other biological functions, such as promoting cell proliferation and differentiation. It has been shown to enhance the growth and differentiation of neuronal cells, which may have implications in the treatment of neurodegenerative diseases. Recombinant human CST1 protein has also been found to have anti-tumor effects, as it can inhibit the growth and migration of cancer cells.

Applications of Recombinant Human CST1 Protein

The unique structure and activity of recombinant human CST1 protein make it a valuable tool in various research and clinical applications. In research, it is commonly used as a tool to study the role of cysteine proteases in various biological processes. Its inhibitory activity can be used to investigate the function of specific proteases and their involvement in disease pathways. Recombinant human CST1 protein can also be used to develop new therapies for diseases associated with dysregulated protease activity, such as neurodegenerative diseases and cancer.

In clinical settings, recombinant human CST1 protein has potential applications in the treatment of various diseases. Its anti-inflammatory properties make it a promising candidate for the treatment of inflammatory diseases, such as rheumatoid arthritis and psoriasis. It may also have potential as an anti-tumor agent, as studies have shown its ability to inhibit the growth and migration of cancer cells. In addition, recombinant human CST1 protein has been investigated as a potential biomarker for various diseases, as its expression has been linked to certain cancers and neurodegenerative disorders.

Conclusion

Recombinant human CST1 protein is a synthetic form of the human cystatin S protein, produced through genetic engineering techniques. Its structure, activity, and diverse applications make it a valuable tool in understanding and treating various diseases. Its inhibitory activity against cysteine proteases, anti-inflammatory properties, and potential as a biomarker and therapeutic agent make it a promising protein for further research and development.

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CST1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products