Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTNNA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P35221
Molecular weight:
21.97 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Gly666–Ser846
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTNNA1 Protein, N-His

Product name ARO-P10779-100
Uniprot ID P35221
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKS
Molecular weight 21.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly666-Ser846
Aliases /Synonyms Renal carcinoma antigen NY-REN-13, Catenin alpha-1, CTNNA1, Alpha E-catenin, Cadherin-associated protein
Reference ARO-P10779
Note For research use only.
Molecular Constructor
Gly666–Ser846
Product name ARO-P10779-1MG
Uniprot ID P35221
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKS
Molecular weight 21.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly666-Ser846
Aliases /Synonyms Renal carcinoma antigen NY-REN-13, Catenin alpha-1, CTNNA1, Alpha E-catenin, Cadherin-associated protein
Reference ARO-P10779
Note For research use only.
Molecular Constructor
Gly666–Ser846
Product name ARO-P10779-50
Uniprot ID P35221
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKS
Molecular weight 21.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly666-Ser846
Aliases /Synonyms Renal carcinoma antigen NY-REN-13, Catenin alpha-1, CTNNA1, Alpha E-catenin, Cadherin-associated protein
Reference ARO-P10779
Note For research use only.
Molecular Constructor
Gly666–Ser846

Introduction

Recombinant Human CTNNA1 Protein, also known as alpha-catenin, is a key protein involved in cell adhesion and cell signaling processes. This protein is encoded by the CTNNA1 gene and is a member of the catenin family of proteins. It plays a crucial role in maintaining the structural integrity of epithelial tissues and is involved in the regulation of cell proliferation and migration.

Structure of Recombinant Human CTNNA1 Protein

Recombinant Human CTNNA1 Protein is a 102 kDa protein that consists of 906 amino acids. It is composed of three major domains: an N-terminal domain, a central armadillo domain, and a C-terminal domain. The N-terminal domain is responsible for binding to other proteins, while the armadillo domain is involved in protein-protein interactions. The C-terminal domain contains a conserved region that is important for the regulation of cell adhesion and signaling.

Activity of Recombinant Human CTNNA1 Protein

Recombinant Human CTNNA1 Protein is primarily involved in the regulation of cell adhesion and cell signaling. It plays a crucial role in the formation of adherens junctions, which are specialized structures that connect adjacent cells and provide mechanical strength to tissues. This protein also interacts with other proteins, such as cadherins and actin, to regulate cell-cell adhesion and cell migration. Additionally, it is involved in the Wnt signaling pathway, which plays a critical role in embryonic development and tissue homeostasis.

Application of Recombinant Human CTNNA1 Protein

Recombinant Human CTNNA1 Protein has a wide range of applications in both research and therapeutic settings. Some of the key applications of this protein are listed below:

1. Cell Biology Research

Recombinant Human CTNNA1 Protein is widely used in cell biology research to study the mechanisms of cell adhesion and cell signaling. It is commonly used to investigate the role of this protein in the formation of adherens junctions, as well as its interactions with other proteins involved in cell adhesion and migration.

2. Cancer Research

Aberrant expression of Recombinant Human CTNNA1 Protein has been linked to various types of cancer, including breast cancer and ovarian cancer. Therefore, this protein is often used in cancer research to understand its role in tumor growth and metastasis. It is also being explored as a potential therapeutic target for cancer treatment.

3. Drug Development

Recombinant Human CTNNA1 Protein is a potential target for drug development, particularly in the field of cancer therapeutics. By understanding the role of this protein in cancer, researchers can develop drugs that specifically target its activity and inhibit tumor growth.

4. Tissue Engineering

Recombinant Human CTNNA1 Protein is essential for the formation and maintenance of epithelial tissues. Therefore, it has potential applications in tissue engineering, where it can be used to promote the growth and regeneration of damaged tissues.

5. Diagnostic Tool

As Recombinant Human CTNNA1 Protein is involved in various cellular processes, its levels and activity can serve as biomarkers for certain diseases. This protein can be used as a diagnostic tool to detect abnormalities in cell adhesion and signaling, which can aid in the early detection and treatment of diseases.

Conclusion

Recombinant Human CTNNA1 Protein is a crucial protein involved in cell adhesion and signaling processes. Its structure and activity make it a key player in maintaining the structural integrity of tissues and regulating cell proliferation and migration. With its wide range of applications in research and therapeutics, this protein continues to be an important focus of scientific study.

Recombinant Human CTNNA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTNNA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products