Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTRL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P40313
Molecular weight:
25.19 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Val49–Asn264
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTRL Protein, N-His

Product name ARO-P11289-100
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264
Product name ARO-P11289-1MG
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264
Product name ARO-P11289-50
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264

Introduction

Recombinant Human CTRL Protein, also known as recombinant protein or antigen, is a protein that has been produced using recombinant DNA technology. This technology involves inserting a specific gene sequence into a host organism, such as bacteria or yeast, to produce a desired protein. Recombinant Human CTRL Protein is a valuable tool in scientific research and has a wide range of applications in various fields.

Structure of Recombinant Human CTRL Protein

Recombinant Human CTRL Protein is a 54 kDa protein that consists of 480 amino acids. It has a similar structure to the naturally occurring human CTRL protein, with a conserved domain that is essential for its function. The recombinant protein is typically produced in a soluble form, making it easy to purify and use in experiments.

Activity of Recombinant Human CTRL Protein

Recombinant Human CTRL Protein has been shown to have enzymatic activity, specifically as a serine/threonine protein phosphatase. This activity is crucial for its function in regulating various cellular processes, such as cell growth, differentiation, and apoptosis. The recombinant protein has been extensively studied and has been shown to have similar activity to the naturally occurring human CTRL protein.

Applications of Recombinant Human CTRL Protein

Recombinant Human CTRL Protein has a wide range of applications in scientific research, including:

  • Cell Signaling Studies: As a protein phosphatase, Recombinant Human CTRL Protein is essential for studying signaling pathways and their regulation. It can be used to investigate the role of specific phosphatases in different cellular processes.
  • Disease Research: Mutations in the gene that encodes for human CTRL protein have been linked to various diseases, including cancer and neurodegenerative disorders. Recombinant Human CTRL Protein can be used to study the effects of these mutations and their role in disease development.
  • Drug Development: The activity of Recombinant Human CTRL Protein makes it a potential target for drug development. By studying its structure and function, scientists can design drugs that can modulate its activity, leading to potential treatments for diseases associated with CTRL protein dysfunction.
  • Diagnostic Tools: Recombinant Human CTRL Protein can also be used as a diagnostic tool for certain diseases. Its activity can be measured in patient samples, providing valuable information about the disease status and progression.

Conclusion

In conclusion, Recombinant Human CTRL Protein is a valuable tool in scientific research due to its structure, activity, and various applications. Its production using recombinant DNA technology has made it easily accessible and has opened up new avenues for studying cellular processes and developing potential treatments for diseases. Further studies on this protein will continue to enhance our understanding of its role in human health and disease.

Recombinant Human CTRL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTRL Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products