Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTSC, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P53634
Molecular weight:
28.34 kDa

Original price was: $474.00.Current price is: $392.00.

100ug 17% OFF + 392 loyalty points
His Leu231–Leu463
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTSC, N-His

Product name ARO-P13638-100
Uniprot ID P53634
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Molecular weight 28.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu231-Leu463
Aliases /Synonyms Dipeptidyl peptidase 1, Dipeptidyl peptidase I exclusion domain chain, DPPI, Cathepsin J, Dipeptidyl transferase, Dipeptidyl peptidase I heavy chain, CTSC, Dipeptidyl peptidase I, Dipeptidyl peptidase I light chain, CPPI, Cathepsin C, DPP-I
Reference ARO-P13638
Note For research use only.
Molecular Constructor
His Leu231–Leu463
Product name ARO-P13638-1MG
Uniprot ID P53634
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Molecular weight 28.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu231-Leu463
Aliases /Synonyms Dipeptidyl peptidase 1, Dipeptidyl peptidase I exclusion domain chain, DPPI, Cathepsin J, Dipeptidyl transferase, Dipeptidyl peptidase I heavy chain, CTSC, Dipeptidyl peptidase I, Dipeptidyl peptidase I light chain, CPPI, Cathepsin C, DPP-I
Reference ARO-P13638
Note For research use only.
Molecular Constructor
His Leu231–Leu463
Product name ARO-P13638-50
Uniprot ID P53634
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Molecular weight 28.34 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu231-Leu463
Aliases /Synonyms Dipeptidyl peptidase 1, Dipeptidyl peptidase I exclusion domain chain, DPPI, Cathepsin J, Dipeptidyl transferase, Dipeptidyl peptidase I heavy chain, CTSC, Dipeptidyl peptidase I, Dipeptidyl peptidase I light chain, CPPI, Cathepsin C, DPP-I
Reference ARO-P13638
Note For research use only.
Molecular Constructor
His Leu231–Leu463

Recombinant Human CTSC, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTSC, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products