Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CUL4B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13620
Molecular weight:
27.83 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Gly728–Ala913
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CUL4B Protein, N-His

Product name ARO-P12610-100
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913
Product name ARO-P12610-1MG
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913
Product name ARO-P12610-50
Uniprot ID Q13620
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
Molecular weight 27.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly728-Ala913
Aliases /Synonyms Cullin-4B, CUL-4B, CUL4B, KIAA0695
Reference ARO-P12610
Note For research use only.
Molecular Constructor
Gly728–Ala913

Introduction

Recombinant Human CUL4B Protein, also known as Cullin 4B, is a protein that plays a critical role in regulating various cellular processes such as cell cycle progression, DNA damage response, and protein degradation. This protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human CUL4B Protein.

Structure of Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein is a 100 kDa protein that belongs to the cullin family of proteins. It is composed of 897 amino acids and contains a conserved N-terminal domain, a central cullin homology domain, and a C-terminal domain. The N-terminal domain is responsible for binding to the substrate receptor, while the cullin homology domain interacts with other proteins to form a multi-subunit E3 ubiquitin ligase complex. The C-terminal domain is involved in protein-protein interactions and is essential for the proper functioning of the protein.

Activity of Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein is a key component of the Cullin-RING E3 ubiquitin ligase complex, which plays a crucial role in the ubiquitin-proteasome system. This system is responsible for the targeted degradation of proteins, thereby regulating various cellular processes. CUL4B acts as a scaffold protein, bringing together the substrate receptor and the E2 ubiquitin-conjugating enzyme. This complex then catalyzes the transfer of ubiquitin to the target protein, marking it for degradation by the proteasome. This process is essential for maintaining cellular homeostasis and regulating protein levels.

Applications of Recombinant Human CUL4B Protein

Recombinant Human CUL4B Protein has various applications in both research and therapeutic settings. Here are some of its key applications:

1. Protein Degradation Studies

As a key component of the Cullin-RING E3 ubiquitin ligase complex, Recombinant Human CUL4B Protein is widely used in protein degradation studies. Researchers can use this protein to study the targeted degradation of specific proteins and understand their role in various cellular processes.

2. Drug Discovery

The ubiquitin-proteasome system plays a crucial role in regulating protein levels, making it an attractive target for drug discovery. Recombinant Human CUL4B Protein can be used to screen potential drug candidates that can modulate the activity of this protein and potentially treat diseases caused by abnormal protein levels.

3. Cancer Research

Aberrant expression of CUL4B has been linked to various types of cancer, making it an important target for cancer research. Recombinant Human CUL4B Protein can be used to study the role of this protein in cancer development and progression, as well as to develop potential therapies targeting this protein.

4. Protein-Protein Interaction Studies

The Cullin-RING E3 ubiquitin ligase complex is known to interact with various proteins, making it essential for various cellular processes. Recombinant Human CUL4B Protein can be used to study these interactions and understand the role of this complex in regulating cellular processes.

5. Therapeutic Applications

Recombinant Human CUL4B Protein has shown potential as a therapeutic agent for various diseases. For example, it has been shown to have neuroprotective effects in models of Huntington’s disease and Alzheimer’s disease. Additionally, it has been suggested as a potential target for the treatment of inflammatory diseases and autoimmune disorders.

Conclusion

Recombinant Human CUL4B Protein is a valuable tool for scientific research and has various applications in both research and therapeutic settings. Its well-defined structure and critical role in regulating cellular processes make

Recombinant Human CUL4B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CUL4B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products