Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CYGB, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WWM9
Molecular weight:
23.71 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Met1–Pro190
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CYGB, N-His

Product name ARO-P13219-100
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190
Product name ARO-P13219-1MG
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190
Product name ARO-P13219-50
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190

Introduction

Recombinant Human CYGB (Cytoglobin) is a protein that plays a crucial role in cellular metabolism and oxygen transport. It is a member of the globin family of proteins and is highly conserved across species, with 99% similarity between human and mouse CYGB. Recombinant Human CYGB is produced through genetic engineering techniques, making it a valuable tool for various research and therapeutic applications.

Structure of Recombinant Human CYGB

Recombinant Human CYGB is composed of 190 amino acids and has a molecular weight of approximately 21 kDa. It has a similar structure to other globin proteins, consisting of eight alpha-helices and a heme group in the center. The heme group is responsible for binding and transporting oxygen molecules, making CYGB a key player in cellular respiration.

Studies have shown that Recombinant Human CYGB has a hexacoordinate heme binding site, meaning that the heme group is bound to six amino acid residues. This unique feature allows CYGB to bind and release oxygen more efficiently compared to other globin proteins, making it an important factor in oxygen homeostasis.

Activity of Recombinant Human CYGB

The primary function of Recombinant Human CYGB is to facilitate oxygen transport and storage in cells. It is found in various tissues, including the heart, skeletal muscles, and brain, where it plays a crucial role in maintaining oxygen balance. CYGB also has antioxidant properties, protecting cells from oxidative stress and maintaining cellular redox balance.

Aside from its role in oxygen metabolism, Recombinant Human CYGB has been found to play a role in cell proliferation and differentiation. Studies have shown that CYGB expression is upregulated in cancer cells, and its overexpression can promote cell growth and survival. This makes CYGB a potential target for cancer therapy.

Application of Recombinant Human CYGB

The unique structure and activity of Recombinant Human CYGB make it a valuable tool for various research and therapeutic applications. Its ability to bind and transport oxygen efficiently makes it a promising candidate for oxygen therapeutics, especially in conditions where oxygen delivery is compromised, such as stroke and heart attack.

Recombinant Human CYGB is also used in research to study its role in oxygen metabolism and cellular functions. Its antioxidant properties make it a potential target for neurodegenerative diseases, such as Alzheimer’s and Parkinson’s. CYGB is also being investigated for its role in cancer development and progression, with potential applications in cancer therapy.

Conclusion

Recombinant Human CYGB is a highly conserved globin protein with a crucial role in cellular metabolism and oxygen transport. Its unique structure and activity make it a valuable tool for various research and therapeutic applications, including oxygen therapeutics, neurodegenerative diseases, and cancer therapy. Further studies on Recombinant Human CYGB are needed to fully understand its functions and potential applications in the field of medicine.

Keywords: Recombinant Human CYGB, globin, oxygen transport, oxygen therapeutics, neurodegenerative diseases, cancer therapy.

Recombinant Human CYGB, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CYGB, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products