Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DARS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6PI48
Molecular weight:
68.95 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Ser59–His645
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DARS2 Protein, N-His

Product name ARO-P12190-100
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645
Product name ARO-P12190-1MG
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645
Product name ARO-P12190-50
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645

Introduction

Recombinant Human DARS2 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is a member of the aminoacyl-tRNA synthetase family and plays a crucial role in protein synthesis by catalyzing the attachment of specific amino acids to their corresponding tRNA molecules. DARS2 is a mitochondrial protein, meaning it is located in the mitochondria, and is essential for maintaining the integrity and function of this organelle. In this article, we will discuss the structure, activity, and applications of Recombinant Human DARS2 Protein.

Structure of Recombinant Human DARS2 Protein

Recombinant Human DARS2 Protein is a 50 kDa protein consisting of 474 amino acids. It has a conserved catalytic domain and an anticodon-binding domain, both of which are important for its enzymatic activity. The protein also contains a mitochondrial targeting sequence that directs it to the mitochondria. This targeting sequence is removed during the maturation process, resulting in the mature form of the protein. The three-dimensional structure of DARS2 has been determined through X-ray crystallography, revealing its overall shape and active site.

Activity of Recombinant Human DARS2 Protein

The main activity of Recombinant Human DARS2 Protein is to catalyze the attachment of the amino acid aspartate to its corresponding tRNA molecule. This process, known as aminoacylation, is essential for the translation of genetic information into proteins. DARS2 specifically recognizes the tRNAAsp molecule and binds to it, forming a complex that allows for the transfer of aspartate. This process is critical for the accurate and efficient synthesis of proteins in the mitochondria.

In addition to its role in protein synthesis, DARS2 has also been found to have other activities. It has been shown to interact with other proteins involved in mitochondrial function, such as mitochondrial ribosomal proteins and proteins involved in RNA processing. DARS2 has also been linked to the regulation of mitochondrial DNA replication and maintenance of the mitochondrial genome. These activities further highlight the importance of DARS2 in maintaining the integrity and function of the mitochondria.

Applications of Recombinant Human DARS2 Protein

Recombinant Human DARS2 Protein has a wide range of applications in both research and therapeutic settings. Its role in protein synthesis makes it a valuable tool for studying the mechanisms of translation and protein synthesis in the mitochondria. It can also be used to study the interactions between DARS2 and other proteins involved in mitochondrial function.

In a therapeutic context, DARS2 has been found to be mutated in some cases of leukoencephalopathy, a rare genetic disorder that affects the white matter of the brain. Recombinant Human DARS2 Protein can be used to study the effects of these mutations and potentially develop treatments for this disorder. Additionally, DARS2 has been identified as a potential target for novel antibiotics, as it is essential for bacterial protein synthesis and can be inhibited by certain compounds.

Conclusion

Recombinant Human DARS2 Protein is a crucial protein involved in protein synthesis and maintenance of the mitochondria. Its structure and activity have been extensively studied, and it has a wide range of applications in research and therapeutics. As our understanding of the role of DARS2 in mitochondrial function continues to grow, it is likely that this protein will play an even more significant role in various fields of science and medicine.

Recombinant Human DARS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DARS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products