Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13838
Molecular weight:
22.17 kDa

Original price was: $370.00.Current price is: $327.00.

100ug 12% OFF + 327 loyalty points
Leu259–Arg428
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

Product name ARO-P12659-100
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428
Product name ARO-P12659-1MG
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428
Product name ARO-P12659-50
Uniprot ID Q13838
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular weight 22.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu259-Arg428
Aliases /Synonyms BAT1, Spliceosome RNA helicase DDX39B, ATP-dependent RNA helicase p47, DEAD box protein UAP56, DDX39B, UAP56, HLA-B-associated transcript 1 protein, 56 kDa U2AF65-associated protein
Reference ARO-P12659
Note For research use only.
Molecular Constructor
Leu259–Arg428

Introduction

Recombinant Human DDX39B/BAT1/UAP56 Protein, also known as DEAD-box helicase 39B, is a highly conserved protein that plays a crucial role in RNA metabolism and processing. This protein is encoded by the DDX39B gene and is essential for the proper functioning of various cellular processes, including transcription, splicing, and translation. In this article, we will discuss the structure, activity, and applications of Recombinant Human DDX39B/BAT1/UAP56 Protein.

Structure of Recombinant Human DDX39B/BAT1/UAP56 Protein

Recombinant Human DDX39B/BAT1/UAP56 Protein is a 56 kDa protein consisting of 510 amino acids. It belongs to the DEAD-box helicase family, which is characterized by the presence of a conserved DEAD (Asp-Glu-Ala-Asp) motif. This motif is essential for the ATPase and helicase activities of DDX39B. The protein also contains a C-terminal domain that is responsible for its interaction with other proteins involved in RNA metabolism.

Activity of Recombinant Human DDX39B/BAT1/UAP56 Protein

Recombinant Human DDX39B/BAT1/UAP56 Protein is an ATP-dependent RNA helicase that plays a crucial role in RNA processing. It is involved in the unwinding of RNA secondary structures, which is essential for various cellular processes, including transcription, splicing, and translation. DDX39B also plays a role in the assembly of ribonucleoprotein complexes and the transport of mRNAs from the nucleus to the cytoplasm.

The ATPase activity of DDX39B is essential for its helicase activity. It hydrolyzes ATP to ADP, which provides the energy required for the unwinding of RNA structures. This activity is crucial for the proper functioning of DDX39B in RNA metabolism. Additionally, DDX39B is also involved in the regulation of alternative splicing, which is essential for the generation of diverse protein isoforms from a single gene.

Applications of Recombinant Human DDX39B/BAT1/UAP56 Protein

Recombinant Human DDX39B/BAT1/UAP56 Protein has various applications in both basic research and clinical settings. Its role in RNA metabolism makes it a valuable tool for studying the mechanisms of gene expression and regulation. DDX39B has been shown to interact with various proteins involved in RNA processing, and its overexpression or knockdown can affect the splicing patterns of specific genes.

Moreover, DDX39B has also been linked to various diseases, including cancer and neurodegenerative disorders. Its aberrant expression or mutations have been observed in certain types of cancer, such as breast cancer and leukemia. This makes DDX39B a potential diagnostic and therapeutic target for these diseases.

Recombinant Human DDX39B/BAT1/UAP56 Protein has also been used in the production of therapeutic proteins. Its ability to interact with other proteins involved in RNA metabolism makes it a useful tool for improving the expression and stability of recombinant proteins. It has been shown to enhance the expression of various therapeutic proteins, including antibodies and cytokines, in both mammalian and bacterial expression systems.

In addition to its role in RNA metabolism, DDX39B has also been linked to DNA repair and genome stability. Its interaction with other proteins involved in these processes suggests its potential role in maintaining genomic integrity. This makes DDX39B a promising target for the development of novel cancer therapies.

Conclusion

In summary, Recombinant Human DDX39B/BAT1/UAP56 Protein is a highly conserved protein that plays a crucial role in RNA metabolism and processing. Its structure, activity, and applications make it a valuable tool for studying gene expression and regulation, as well as a potential target for the development of novel therapeutics. Further research on DDX39B is

Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX39B/BAT1/UAP56 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products