Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DEFA3, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P59666
Molecular weight:
34.99 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
GST Pro21–Cys94
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DEFA3, N-GST

Product name ARO-P13598-100
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94
Product name ARO-P13598-1MG
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94
Product name ARO-P13598-50
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94

Introduction

Recombinant Human DEFA3, also known as defensin alpha 3, is a type of recombinant protein that plays a crucial role in the innate immune response of the human body. It is a small, cationic peptide that is produced by the epithelial cells of various organs, including the skin, respiratory tract, and gastrointestinal tract. In this article, we will explore the structure, activity, and potential applications of recombinant Human DEFA3.

Structure of Recombinant Human DEFA3

Recombinant Human DEFA3 is a 47 amino acid protein with a molecular weight of approximately 5 kDa. It belongs to the alpha-defensin family, which consists of six different subtypes (DEFA1, DEFA2, DEFA3, DEFA4, DEFA5, and DEFA6). The primary structure of DEFA3 is highly conserved among different species, with 99% sequence identity between human and chimpanzee DEFA3.

The three-dimensional structure of recombinant Human DEFA3 is characterized by a beta-sheet core and three disulfide bonds, which give it a stable and compact conformation. These structural features are essential for its antimicrobial activity and allow it to penetrate microbial membranes and disrupt their integrity.

Activity of Recombinant Human DEFA3

Recombinant Human DEFA3 is a potent antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. It exerts its antimicrobial effects by disrupting the cell membrane of microorganisms, leading to cell death. This mechanism of action is different from traditional antibiotics, making DEFA3 a promising alternative for combating drug-resistant pathogens.

Besides its antimicrobial activity, recombinant Human DEFA3 also has immunomodulatory properties. It can activate immune cells, such as neutrophils and macrophages, to enhance their ability to eliminate pathogens. DEFA3 also has anti-inflammatory effects by inhibiting the production of pro-inflammatory cytokines, making it a potential therapeutic agent for inflammatory diseases.

Applications of Recombinant Human DEFA3

The antimicrobial and immunomodulatory properties of recombinant Human DEFA3 make it a promising candidate for various applications in the medical and biotechnology fields.

One potential application of DEFA3 is in the development of novel antibiotics. With the rise of antibiotic-resistant bacteria, there is a pressing need for new antimicrobial agents. Recombinant Human DEFA3 has shown promising activity against drug-resistant pathogens, making it a potential candidate for the development of new antibiotics.

Another potential application of recombinant Human DEFA3 is in the treatment of inflammatory diseases. Its ability to modulate the immune response and reduce inflammation makes it a potential therapeutic option for conditions such as inflammatory bowel disease, psoriasis, and asthma.

Furthermore, recombinant Human DEFA3 can also be used in the biotechnology industry. Its antimicrobial properties make it a potential preservative for food and cosmetic products. It can also be incorporated into medical devices to prevent infections.

Conclusion

In summary, recombinant Human DEFA3 is a small, cationic peptide with potent antimicrobial and immunomodulatory properties. Its unique structure and mechanism of action make it a promising candidate for the development of new antibiotics and treatments for inflammatory diseases. Additionally, it has potential applications in the biotechnology industry. Further research and development of recombinant Human DEFA3 could lead to the discovery of new therapeutic options for various diseases and contribute to the fight against drug-resistant pathogens.

Keywords

Recombinant protein, antigen, defensin alpha 3, innate immune response, antimicrobial peptide, immunomodulatory, drug-resistant, antibiotics, inflammatory diseases, biotechnology.

Recombinant Human DEFA3, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DEFA3, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products