Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DEFB119, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N690
Molecular weight:
34.33 kDa

Original price was: $501.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Lys22–Pro84
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DEFB119, N-GST

Product name ARO-P13250-100
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84
Product name ARO-P13250-1MG
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84
Product name ARO-P13250-50
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84

Introduction

Recombinant Human DEFB119 is a synthetic form of the human defensin 119 protein, which is a member of the defensin family of antimicrobial peptides. These peptides play a crucial role in the innate immune response, providing protection against a wide range of pathogens. Recombinant Human DEFB119 is produced through genetic engineering techniques, allowing for large-scale production and potential therapeutic applications.

Structure of Recombinant Human DEFB119

The structure of Recombinant Human DEFB119 is similar to that of other defensin peptides, consisting of a linear chain of 29 amino acids. It has a characteristic six-cysteine motif, which forms three disulfide bonds that stabilize the peptide’s structure. The amino acid sequence of Recombinant Human DEFB119 is identical to the native human protein, ensuring its functional and structural integrity.

Activity of Recombinant Human DEFB119

Recombinant Human DEFB119 exhibits potent antimicrobial activity against a broad range of Gram-positive and Gram-negative bacteria, including drug-resistant strains. It acts by disrupting the bacterial cell membrane, leading to cell death. This mechanism of action is different from traditional antibiotics, making Recombinant Human DEFB119 a promising candidate for combating antibiotic resistance.

In addition to its antimicrobial activity, Recombinant Human DEFB119 also has immunomodulatory properties. It can stimulate the production of cytokines and chemokines, which are essential for the recruitment and activation of immune cells. This makes Recombinant Human DEFB119 a potential candidate for use in immunotherapies and vaccines.

Application of Recombinant Human DEFB119

The unique properties of Recombinant Human DEFB119 make it a promising candidate for various therapeutic applications. Its potent antimicrobial activity makes it a potential treatment for bacterial infections, including those caused by drug-resistant strains. It can also be used as an adjuvant in combination with traditional antibiotics to enhance their efficacy.

The immunomodulatory properties of Recombinant Human DEFB119 also make it a potential candidate for use in immunotherapies. It can be used to stimulate the immune system and enhance the body’s natural defense mechanisms against infections and diseases. Additionally, Recombinant Human DEFB119 can be incorporated into vaccines to improve their effectiveness.

Conclusion

In conclusion, Recombinant Human DEFB119 is a synthetic form of the human defensin 119 protein with a similar structure and activity to the native protein. It exhibits potent antimicrobial activity against a wide range of bacteria and has immunomodulatory properties that make it a promising candidate for various therapeutic applications. Further research and clinical trials are needed to fully explore the potential of Recombinant Human DEFB119 in the treatment of infections and as an immunomodulatory agent.

Recombinant Human DEFB119, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DEFB119, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products