Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAAF4 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WXU2
Molecular weight:
37.20 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Pro2–Ala80
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAAF4 Protein, N-GST & C-His

Product name ARO-P12186-100
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80
Product name ARO-P12186-1MG
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80
Product name ARO-P12186-50
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80

Introduction to Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein, also known as DNAI1-associated factor 4, is a protein that plays a crucial role in the functioning of cilia, which are tiny hair-like structures found on the surface of many cells in our body. This protein is produced through recombinant DNA technology, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human DNAAF4 Protein

The gene encoding for Recombinant Human DNAAF4 Protein is located on chromosome 9 and consists of 15 exons. The protein itself is composed of 476 amino acids with a molecular weight of approximately 54 kDa. It contains a conserved domain known as the WD40 repeat, which is involved in protein-protein interactions. This domain is crucial for the proper functioning of the protein.

The crystal structure of Recombinant Human DNAAF4 Protein has been determined, revealing that it forms a homodimer with two identical subunits. Each subunit consists of seven WD40 repeats, forming a seven-bladed β-propeller structure. This unique structure allows the protein to interact with other proteins and play a role in various cellular processes.

Activity of Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein is primarily involved in the assembly and functioning of cilia. Cilia are essential for various cellular processes, including cell motility, sensory perception, and signaling. Defects in cilia have been linked to several diseases, collectively known as ciliopathies. These include primary ciliary dyskinesia, a genetic disorder characterized by impaired cilia function, and Bardet-Biedl syndrome, a rare genetic disorder that affects multiple organs.

Recombinant Human DNAAF4 Protein interacts with other proteins, such as DNAI1 and DNAH5, to form a complex known as the dynein axonemal intermediate chain 1 (DNAI1) complex. This complex is essential for the proper functioning of cilia, as it is responsible for the movement of cilia. Recombinant Human DNAAF4 Protein also plays a role in the assembly of the DNAI1 complex, ensuring its proper functioning.

Applications of Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein has various applications in scientific research and medicine. Its role in cilia assembly and functioning makes it a valuable tool for studying ciliopathies and other diseases related to cilia dysfunction. Researchers can use this protein to study the structure and function of cilia and understand the underlying mechanisms of cilia-related diseases.

In addition, Recombinant Human DNAAF4 Protein can also be used as an antigen in the development of diagnostic tests for ciliopathies. By using this protein as an antigen, scientists can detect the presence of antibodies against it in patient samples, which can help in the diagnosis of cilia-related diseases.

Furthermore, Recombinant Human DNAAF4 Protein has potential therapeutic applications. As ciliopathies are currently incurable, understanding the role of this protein in cilia function can lead to the development of targeted therapies for these diseases. Additionally, Recombinant Human DNAAF4 Protein can also be used in gene therapy approaches to treat cilia-related disorders.

Conclusion

In summary, Recombinant Human DNAAF4 Protein is a crucial protein involved in cilia assembly and functioning. Its unique structure and activity make it a valuable tool for scientific research and potential therapeutic applications. With further research and understanding of this protein, we can gain insights into cilia-related diseases and develop effective treatments for them.

Recombinant Human DNAAF4 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human DNAAF4 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products