Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAJA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P31689
Molecular weight:
27.14 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Asn106–Asn327
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAJA1 Protein, N-His

Product name ARO-P11706-100
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327
Product name ARO-P11706-1MG
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327
Product name ARO-P11706-50
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327

Introduction

Recombinant Human DNAJA1 Protein is a type of recombinant protein that plays a crucial role in protein folding and degradation pathways. It is a member of the heat shock protein 40 (HSP40) family and is involved in various cellular processes such as protein quality control, stress response, and immune response. In this article, we will discuss the structure, activity, and application of Recombinant Human DNAJA1 Protein.

Structure of Recombinant Human DNAJA1 Protein

Recombinant Human DNAJA1 Protein is a 44 kDa protein consisting of 395 amino acids. It has a highly conserved J domain, which is responsible for its chaperone activity. This domain contains a tripeptide motif (HPD) that interacts with the ATPase domain of HSP70, facilitating the transfer of client proteins to the HSP70 chaperone. The J domain is followed by a glycine/phenylalanine-rich (G/F) domain, which is involved in substrate binding. The C-terminal region of the protein has a zinc finger domain, which is responsible for protein-protein interactions.

Activity of Recombinant Human DNAJA1 Protein

Recombinant Human DNAJA1 Protein acts as a co-chaperone for HSP70, a major chaperone involved in protein folding and degradation pathways. It interacts with HSP70 through its J domain and assists in the transfer of client proteins to HSP70 for proper folding or degradation. In addition, it also has ATPase activity, which is essential for its chaperone function. Recombinant Human DNAJA1 Protein is also involved in the regulation of the heat shock response, as it can interact with heat shock transcription factors and modulate their activity.

Application of Recombinant Human DNAJA1 Protein

Recombinant Human DNAJA1 Protein has various applications in the field of biotechnology and medicine. It is commonly used in protein purification and production, as it can assist in the proper folding of recombinant proteins. It is also used in the development of therapeutic strategies for protein misfolding diseases, as it can help in the proper folding of misfolded proteins. Moreover, Recombinant Human DNAJA1 Protein has been studied for its potential role in cancer, as it is involved in the degradation of misfolded and damaged proteins that can contribute to tumorigenesis.

Recombinant Human DNAJA1 Protein as an Antigen

Recombinant Human DNAJA1 Protein has also been studied as a potential antigen for vaccine development. It has been shown to induce a strong immune response in animal models, making it a promising candidate for vaccine development. In addition, it has been found to be highly expressed in cancer cells, making it a potential target for cancer immunotherapy.

Conclusion

In summary, Recombinant Human DNAJA1 Protein is a crucial co-chaperone involved in protein folding and degradation pathways. Its unique structure and activity make it a valuable tool in protein purification and production, as well as a potential therapeutic target for protein misfolding diseases and cancer. Furthermore, its potential as an antigen for vaccine development highlights its importance in the field of biotechnology and medicine. Further research on Recombinant Human DNAJA1 Protein may lead to the development of novel therapies for various diseases and disorders.

Recombinant Human DNAJA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DNAJA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products