Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92785
Molecular weight:
25.12 kDa

Original price was: $374.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Glu290–Ser391
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

Product name ARO-P11707-100
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391
Product name ARO-P11707-1MG
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391
Product name ARO-P11707-50
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391

Recombinant Human DPF2 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where a specific gene is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein. Recombinant proteins have become essential tools in various fields of research, including biotechnology, medicine, and diagnostics.

Structure of Recombinant Human DPF2 Protein

The Recombinant Human DPF2 Protein is a 147 kDa protein that belongs to the D4, zinc finger-containing protein family. It is encoded by the DPF2 gene, located on chromosome 8 in humans. The protein consists of 1273 amino acids and contains two conserved domains: the C2H2-type zinc finger domain and the PHD-type zinc finger domain.

The C2H2-type zinc finger domain is responsible for DNA binding, while the PHD-type zinc finger domain is involved in protein-protein interactions. These two domains play a crucial role in the function of Recombinant Human DPF2 Protein.

Structure of Recombinant Human DPF2 Protein

Activity of Recombinant Human DPF2 Protein

Recombinant Human DPF2 Protein is a transcriptional co-activator that regulates gene expression by binding to specific DNA sequences and interacting with other proteins. It is a key component of the transcriptional machinery and is involved in various cellular processes, including cell proliferation, differentiation, and development.

Studies have shown that Recombinant Human DPF2 Protein plays a critical role in the regulation of gene expression in different tissues, such as the brain, heart, and skeletal muscle. It has also been linked to several diseases, including cancer and neurological disorders.

Application of Recombinant Human DPF2 Protein

Recombinant Human DPF2 Protein has various applications in both research and clinical settings. Its ability to regulate gene expression makes it a valuable tool in studying the molecular mechanisms of different diseases and identifying potential therapeutic targets.

In addition, Recombinant Human DPF2 Protein has been used in the production of monoclonal antibodies for the diagnosis and treatment of cancer. It has also been used in the development of gene therapy strategies for inherited diseases caused by mutations in the DPF2 gene.

Furthermore, Recombinant Human DPF2 Protein has been used in the production of vaccines as an antigen. Its high immunogenicity makes it an ideal candidate for eliciting an immune response and providing protection against specific diseases.

Conclusion

In summary, Recombinant Human DPF2 Protein is a crucial protein with diverse roles in gene regulation and cellular processes. Its structure, activity, and application make it a valuable tool in various fields of research and medicine. Further studies on this protein may lead to a better understanding of its function and potential therapeutic applications.

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products