Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DSPP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZW4
Molecular weight:
16.33 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Ile16–Ala146
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DSPP, N-His

Product name ARO-P13048-100
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146
Product name ARO-P13048-1MG
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146
Product name ARO-P13048-50
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146

Introduction to Recombinant Human DSPP

Recombinant Human DSPP (Dentin Sialophosphoprotein) is a protein that plays a crucial role in the formation and mineralization of dentin, a hard tissue found in teeth. It is a recombinant protein, meaning it is produced in a laboratory by combining genetic material from different sources. This allows for the production of large quantities of the protein, which can then be used for various scientific and medical applications.

Structure of Recombinant Human DSPP

The human DSPP gene is located on chromosome 4 and contains 7 exons, which are the coding sequences for the protein. The protein is composed of two main domains: the dentin sialoprotein (DSP) domain and the dentin phosphoprotein (DPP) domain. The DSP domain is rich in acidic amino acids and contains a high concentration of sialic acid, which is important for the mineralization of dentin. The DPP domain, on the other hand, is rich in phosphorylated amino acids, which are crucial for the formation of hydroxyapatite crystals, the main component of dentin.

Recombinant Human DSPP is produced by inserting the human DSPP gene into a suitable expression vector, such as a bacterial or mammalian cell. The protein is then synthesized using the cellular machinery of the host organism, resulting in a protein with the same amino acid sequence as the natural human DSPP.

Activity of Recombinant Human DSPP

The main function of DSPP is to regulate the formation and mineralization of dentin. It does this by interacting with other proteins, such as dentin matrix protein 1 (DMP1) and dentin phosphoprotein (DPP). These interactions are crucial for the proper development and maintenance of teeth.

Studies have shown that mutations in the DSPP gene can lead to various dental disorders, such as dentinogenesis imperfecta and dentin dysplasia. Recombinant Human DSPP has been used in research to better understand the role of this protein in these disorders and to develop potential treatments.

Additionally, Recombinant Human DSPP has been shown to have potential applications in tissue engineering and regenerative medicine. It can be used to promote the growth and differentiation of dental stem cells, which could lead to the development of new treatments for tooth decay and other dental diseases.

Application of Recombinant Human DSPP

Recombinant Human DSPP has a wide range of applications in both scientific research and medical treatments. Some of its specific applications include:

1. Dental Research

Recombinant Human DSPP is commonly used in dental research to study the role of this protein in tooth development and diseases. It has also been used to develop animal models for dental disorders, which can aid in the development of new treatments.

2. Diagnosis of Dental Disorders

Mutations in the DSPP gene have been linked to various dental disorders. Recombinant Human DSPP can be used as an antigen in diagnostic tests to detect these mutations and aid in the diagnosis of these disorders.

3. Tissue Engineering

Recombinant Human DSPP has shown potential in tissue engineering applications, particularly in the field of dentistry. It can be used to promote the growth and differentiation of dental stem cells, which could lead to the development of new treatments for dental diseases.

4. Drug Development

As DSPP plays a crucial role in the mineralization of dentin, Recombinant Human DSPP has been used in drug development studies to identify potential treatments for dental disorders. It has also been used to study the effects of various drugs on dentin formation and mineralization.

5. Dental Implant Coating

Recombinant Human DSPP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DSPP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products