Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FAM3B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P58499
Molecular weight:
19.67 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
His Glu30–Ser187
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FAM3B, N-His

Product name ARO-P13602-100
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187
Product name ARO-P13602-1MG
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187
Product name ARO-P13602-50
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187

Recombinant Human FAM3B, also known as family with sequence similarity 3 member B, is a protein that plays a crucial role in various biological processes. It is a member of the FAM3 superfamily, which consists of proteins that are highly conserved across different species. Recombinant Human FAM3B is produced through genetic engineering techniques, making it a valuable tool for research and therapeutic applications. In this article, we will delve into the structure, activity, and application of this important protein.

Structure of Recombinant Human FAM3B

Recombinant Human FAM3B is a 24-kDa protein consisting of 216 amino acids. It is composed of a single polypeptide chain with a highly conserved cysteine-rich domain at the N-terminus and a variable C-terminus. The cysteine-rich domain is responsible for maintaining the structural integrity of the protein and is essential for its biological activity.

The crystal structure of Recombinant Human FAM3B has been determined, revealing a unique three-dimensional fold with a central β-sheet surrounded by α-helices. This structural arrangement is similar to other members of the FAM3 superfamily, indicating a common evolutionary origin.

Activity of Recombinant Human FAM3B

Recombinant Human FAM3B has been shown to have diverse biological activities, including regulation of cell proliferation, differentiation, and apoptosis. It exerts its effects by binding to specific receptors on the cell surface, triggering downstream signaling pathways.

One of the main functions of Recombinant Human FAM3B is its role in glucose homeostasis. It has been identified as an adipokine, a protein secreted by adipose tissue, and is involved in the regulation of insulin sensitivity and glucose metabolism. Studies have shown that Recombinant Human FAM3B can improve insulin sensitivity and glucose uptake in skeletal muscle, making it a potential therapeutic target for type 2 diabetes.

Additionally, Recombinant Human FAM3B has been found to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines and chemokines, making it a promising candidate for the treatment of inflammatory diseases.

Application of Recombinant Human FAM3B

The unique structure and diverse activities of Recombinant Human FAM3B make it a valuable tool for both research and therapeutic applications. It can be produced in large quantities through recombinant protein expression systems, allowing for easy purification and characterization.

In research, Recombinant Human FAM3B is used as an antigen for the production of specific antibodies. These antibodies can then be used to study the expression and function of FAM3B in different tissues and disease states. Recombinant Human FAM3B can also be used in biochemical assays to investigate its interactions with other proteins and signaling pathways.

On the therapeutic front, Recombinant Human FAM3B holds great potential for the treatment of various diseases. Its role in glucose homeostasis makes it a promising target for the development of new anti-diabetic drugs. It also has potential applications in the treatment of inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease.

Conclusion

In summary, Recombinant Human FAM3B is a highly conserved protein with diverse biological activities. Its unique structure and functions make it a valuable tool for research and a potential target for therapeutic interventions. Further studies on this protein may lead to new insights into its role in various diseases and the development of novel treatments.

Recombinant Human FAM3B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FAM3B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products